Recombinant Full Length Escherichia Coli Coupling Protein Trad(Trad) Protein, His-Tagged
Cat.No. : | RFL29881EF |
Product Overview : | Recombinant Full Length Escherichia coli Coupling protein TraD(traD) Protein (P09130) (1-717aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-717) |
Form : | Lyophilized powder |
AA Sequence : | MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWIKISWQTFVNGCIY WWCTTLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCSEQLWSAFVLAAVVAL VICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPII RDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNP LDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRS YSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHN GEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRA FFRSPSHKIAEFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSL PDLTCYVTLPGPYPAVKLSLKYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMA SLFEPDVPEVVSGEDVTQAEQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQ QLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | traD |
Synonyms | traD; ECOK12F102; Coupling protein TraD; DNA transport protein TraD |
UniProt ID | P09130 |
◆ Recombinant Proteins | ||
CHTOP-1836HF | Recombinant Full Length Human CHTOP Protein, GST-tagged | +Inquiry |
KAZALD1-8458M | Recombinant Mouse KAZALD1 Protein | +Inquiry |
EPO-4083H | Recombinant Human EPO Protein (Met1-Arg193), C-Fc tagged | +Inquiry |
Osm-4619M | Recombinant Mouse Osm Protein, Myc/DDK-tagged | +Inquiry |
Slc30a3-2072M | Recombinant Mouse Slc30a3 Protein, His&GST-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
H3N2-03I | Active Native IAV H3N2 Protein | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A1-2861HCL | Recombinant Human S100A1 cell lysate | +Inquiry |
C1orf189-8169HCL | Recombinant Human C1orf189 293 Cell Lysate | +Inquiry |
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
TPD52L1-1813HCL | Recombinant Human TPD52L1 cell lysate | +Inquiry |
NINJ2-1196HCL | Recombinant Human NINJ2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All traD Products
Required fields are marked with *
My Review for All traD Products
Required fields are marked with *
0
Inquiry Basket