Recombinant Full Length Escherichia Coli Biofilm Pga Synthesis Protein Pgad(Pgad) Protein, His-Tagged
Cat.No. : | RFL29926EF |
Product Overview : | Recombinant Full Length Escherichia coli Biofilm PGA synthesis protein PgaD(pgaD) Protein (P69432) (1-137aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-137) |
Form : | Lyophilized powder |
AA Sequence : | MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT SQGQIKMVVSEKALVRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pgaD |
Synonyms | pgaD; ycdP; b1021; JW1006; Biofilm PGA synthesis protein PgaD |
UniProt ID | P69432 |
◆ Recombinant Proteins | ||
TEK-2758H | Recombinant Human TEK Protein, His-tagged | +Inquiry |
IgG3Fc-963M | Recombinant Mouse IgG3Fc Protein | +Inquiry |
YRZF-2799B | Recombinant Bacillus subtilis YRZF protein, His-tagged | +Inquiry |
Epyc-2850M | Recombinant Mouse Epyc Protein, Myc/DDK-tagged | +Inquiry |
SOCS2-3514H | Recombinant Human SOCS2 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
GPIIbIIIa-73H | Native Human GPIIbIIIa | +Inquiry |
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM86C-6340HCL | Recombinant Human FAM86C 293 Cell Lysate | +Inquiry |
CLIC3-364HCL | Recombinant Human CLIC3 cell lysate | +Inquiry |
NDUFB9-3901HCL | Recombinant Human NDUFB9 293 Cell Lysate | +Inquiry |
IDI1-834HCL | Recombinant Human IDI1 cell lysate | +Inquiry |
MNX1-4268HCL | Recombinant Human MNX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pgaD Products
Required fields are marked with *
My Review for All pgaD Products
Required fields are marked with *
0
Inquiry Basket