Recombinant Full Length Escherichia Coli Aerotaxis Receptor(Aer) Protein, His-Tagged
Cat.No. : | RFL4278EF |
Product Overview : | Recombinant Full Length Escherichia coli Aerotaxis receptor(aer) Protein (P50466) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MSSHPYVTQQNTPLADDTTLMSTTDLQSYITHANDTFVQVSGYTLQELQGQPHNMVRHPD MPKAAFADMWFTLKKGEPWSGIVKNRRKNGDHYWVRANAVPMVREGKISGYMSIRTRATD EEIAAVEPLYKALNAGRTSKRIHKGLVVRKGWLGKLPSLPLRWRARGVMTLMFILLAAML WFVAAPVVTYILCALVVLLASACFEWQIVRPIENVAHQALKVATGERNSVEHLNRSDELG LTLRAVGQLGLMCRWLINDVSSQVSSVRNGSETLAKGTDELNEHTQQTVDNVQQTVATMN QMAASVKQNSATASAADKLSITASNAAVQGGEAMTTVIKTMDDIADSTQRIGTITSLIND IAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRHLASRSANAANDIRKLIDASADKVQS GSQQVHAAGRTMEDIVAQVKNVTQLIAQISHSTLEQADGLSSLTRAVDELNLITQKNAEL VEESAQVSAMVKHRASRLEDAVTVLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aer |
Synonyms | aer; air; yqjJ; b3072; JW3043; Aerotaxis receptor |
UniProt ID | P50466 |
◆ Recombinant Proteins | ||
NRG2-693H | Recombinant Human NRG2 Protein (112-405 aa), His-SUMO-tagged | +Inquiry |
PEBP1-29533TH | Recombinant Human PEBP1 | +Inquiry |
FBLN1-1463H | Recombinant Human FBLN1 Protein, His-tagged | +Inquiry |
Reg3b-1794R | Recombinant Rat Reg3b protein, His & T7-tagged | +Inquiry |
KCNAB1A-2273Z | Recombinant Zebrafish KCNAB1A | +Inquiry |
◆ Native Proteins | ||
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLIT2-1683HCL | Recombinant Human SLIT2 293 Cell Lysate | +Inquiry |
PRMT1-500HCL | Recombinant Human PRMT1 lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
LATS2-4813HCL | Recombinant Human LATS2 293 Cell Lysate | +Inquiry |
ANXA9-8825HCL | Recombinant Human ANXA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aer Products
Required fields are marked with *
My Review for All aer Products
Required fields are marked with *
0
Inquiry Basket