Recombinant Full Length Escherichia Coli Aerobic Respiration Control Sensor Protein Arcb(Arcb) Protein, His-Tagged
Cat.No. : | RFL32744EF |
Product Overview : | Recombinant Full Length Escherichia coli Aerobic respiration control sensor protein ArcB(arcB) Protein (P0AEC3) (1-778aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-778) |
Form : | Lyophilized powder |
AA Sequence : | MKQIRLLAQYYVDLMMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIF FGLLITPWAVYFLSVVVEQLEESRQRLSRLVQKLEEMRERDLSLNVQLKDNIAQLNQEIA VREKAEAELQETFGQLKIEIKEREETQIQLEQQSSFLRSFLDASPDLVFYRNEDKEFSGC NRAMELLTGKSEKQLVHLKPADVYSPEAAAKVIETDEKVFRHNVSLTYEQWLDYPDGRKA CFEIRKVPYYDRVGKRHGLMGFGRDITERKRYQDALERASRDKTTFISTISHELRTPLNG IVGLSRILLDTELTAEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVDFTS FLADLENLSALQAQQKGLRFNLEPTLPLPHQVITDGTRLRQILWNLISNAVKFTQQGQVT VRVRYDEGDMLHFEVEDSGIGIPQDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSRRLA KNMGGDITVTSEQGKGSTFTLTIHAPSVAEEVDDAFDEDDMPLPALNVLLVEDIELNVIV ARSVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLDIQLPDMTGLDISRELTKRYPREDL PPLVALTANVLKDKQEYLNAGMDDVLSKPLSVPALTAMIKKFWDTQDDEESTVTTEENSK SEALLDIPMLEQYLELVGPKLITDGLAVFEKMMPGYVSVLESNLTAQDKKGIVEEGHKIK GAAGSVGLRHLQQLGQQIQSPDLPAWEDNVGEWIEEMKEEWRHDVEVLKAWVAKATKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arcB |
Synonyms | arcB; b3210; JW5536; Aerobic respiration control sensor protein ArcB |
UniProt ID | P0AEC3 |
◆ Recombinant Proteins | ||
HAVCR2-7093H | Recombinant Human HAVCR2, His-tagged | +Inquiry |
QSOX1-6090H | Recombinant Human QSOX1 Protein (Ser37-Ala181), N-His tagged | +Inquiry |
RLN2-6180H | Recombinant Human RLN2 Protein (Val23-Cys185), N-His tagged | +Inquiry |
RFL32551HF | Recombinant Full Length Human Solute Carrier Family 25 Member 44(Slc25A44) Protein, His-Tagged | +Inquiry |
Cdh16-860M | Recombinant Mouse Cdh16 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgM-344D | Native Donkey IgM | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEDD4-3886HCL | Recombinant Human NEDD4 293 Cell Lysate | +Inquiry |
CHEK1-438HCL | Recombinant Human CHEK1 cell lysate | +Inquiry |
RTDR1-2125HCL | Recombinant Human RTDR1 293 Cell Lysate | +Inquiry |
WEE1-1930HCL | Recombinant Human WEE1 cell lysate | +Inquiry |
KIF11-4956HCL | Recombinant Human KIF11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arcB Products
Required fields are marked with *
My Review for All arcB Products
Required fields are marked with *
0
Inquiry Basket