Recombinant Full Length Erwinia Carotovora Subsp. Atroseptica Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL32934PF |
Product Overview : | Recombinant Full Length Erwinia carotovora subsp. atroseptica Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q6D9J6) (24-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pectobacterium atrosepticum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-577) |
Form : | Lyophilized powder |
AA Sequence : | SSFGQKLFGNSTTSRFLPVDGAFAFEFQQQGNQLNLRWDIHPDYYLYRAQIKIEGNGATL GKVELPQGESHNDEFFGQVFILRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETR TVPLSQVLATANTDSPINTLSGQTAPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIA SLVLGRKEQLTPRRTLLLSMTYVQGMALTYTLLGLIVAAAGLRFQAALQHPYILIGLSVM FIALALSMFGLYTLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICSPCTTAPLSA ILLYIAQSGNMLAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILA LPVFLLERILGEAWGIRLWSALGIAFFGWALMLTLSSKKGWMRGVQLLLLAGVVISAKPL QDWVFPPTGTAQTHTSALNFAPVANIADLNSALAKSPQPVMLDLYADWCVACKEFEKYTF SDPAVQNHLSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDTQGKEIPGSRVTGFM NAEQFQAHLQKFSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; ECA0618; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q6D9J6 |
◆ Recombinant Proteins | ||
NUTF2-2542H | Recombinant Human Nuclear Transport Factor 2 | +Inquiry |
RFL35283AF | Recombinant Full Length Arabidopsis Thaliana Aquaporin Tip4-1(Tip4-1) Protein, His-Tagged | +Inquiry |
DNAJC2-2165H | Recombinant Human DNAJC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PIGR-36H | Recombinant Human PIGR Protein, C-8His tagged, Biotinylated | +Inquiry |
KREMEN1-8809M | Recombinant Mouse KREMEN1 Protein | +Inquiry |
◆ Native Proteins | ||
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCRTR2-775HCL | Recombinant Human HCRTR2 cell lysate | +Inquiry |
BCAP29-161HCL | Recombinant Human BCAP29 cell lysate | +Inquiry |
MYL10-1158HCL | Recombinant Human MYL10 cell lysate | +Inquiry |
HA-2254HCL | Recombinant H6N1 HA cell lysate | +Inquiry |
CNTNAP1-7390HCL | Recombinant Human CNTNAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket