Recombinant Full Length Erwinia Amylovora Udp-Galactose-Lipid Carrier Transferase(Amsg) Protein, His-Tagged
Cat.No. : | RFL20995EF |
Product Overview : | Recombinant Full Length Erwinia amylovora UDP-galactose-lipid carrier transferase(amsG) Protein (Q46628) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Erwinia Amylovora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MREIEFTFKGLLIRLSLALSDLIFFNIALALAIVLINGFPGEILTGIPQHELDLKIATHI LLSVICVGWFWVRLRHYTYRKPFWFELKEVFRTILIFSIVDLSVSALSKWELSRWIWILT WLLSMAMVPFGRACVKRLLNRKKLWKKQSIIIGSGKNAQEAWQALQSEEMMGFDVIAFYD VDGSQTALELFGVPVLKEEQQLWSLVDSDTQFIVAVEYEQSQSRDRWLKNLATHNCRSVS VIPSLRGVPLYGTDMAYIFSHEVMILRVSNNLAKHSSRFLKRTFDLVGALSIITLLLPAL VILIFMVSRDGGAPIYGHERVGRDGRKFKCLKFRSMVVNSKEVLEEVLRTDPVARAEWDE DFKLKNDPRITRIGHFIRKTSLDELPQLWNVVRGEMSLVGPRPVIEAELERYAGDVDYYF MAKPGMTGLWQVSGRNDVSYETRVYFDSWYVKNWSLWNDIAILFKTIGVVLKRDGAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | amsG |
Synonyms | amsG; UDP-galactose-lipid carrier transferase |
UniProt ID | Q46628 |
◆ Recombinant Proteins | ||
SLC22A6-0601H | Recombinant Human SLC22A6 Protein (A2-L563), 8×His-Strep, Flag tagged | +Inquiry |
GPIB-9404Z | Recombinant Zebrafish GPIB | +Inquiry |
Col1a1-08M | Recombinant Mouse Col1a1 protein, His-tagged | +Inquiry |
UBE2B-31450TH | Recombinant Human UBE2B protein | +Inquiry |
ZP3-8918Z | Recombinant Zebrafish ZP3 | +Inquiry |
◆ Native Proteins | ||
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAS2-8496HCL | Recombinant Human BCAS2 293 Cell Lysate | +Inquiry |
KCNK4-323HCL | Recombinant Human KCNK4 Lysate | +Inquiry |
HAVCR2-001CCL | Recombinant Cynomolgus HAVCR2 cell lysate | +Inquiry |
DLL4-2495MCL | Recombinant Mouse DLL4 cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All amsG Products
Required fields are marked with *
My Review for All amsG Products
Required fields are marked with *
0
Inquiry Basket