Recombinant Full Length Equine Herpesvirus 1 Envelope Glycoprotein I(Gi) Protein, His-Tagged
Cat.No. : | RFL29690EF |
Product Overview : | Recombinant Full Length Equine herpesvirus 1 Envelope glycoprotein I(GI) Protein (Q6DLD8) (23-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EHV1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-424) |
Form : | Lyophilized powder |
AA Sequence : | IIYRGEHMSMYLNASSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYSSV CYTVIQTISYESCPRVANNAFRSCLHKTSKHYHDYFRVNASVETNVLLNITKPQPTDSGA YILRVKLDHAPTADVFGVSAFVYDLKSKTVPDPMPTTQTVEPTTSYVSTPTYDYTDDVTT ETESTSTSTQQAMTSTQTPSATWGTQLTTELPTNETVVIGQEALLCHWFQPSTRVPTLYL HLLGRTGNLPEDVLLVEDSEFLRTTSPAHRPSASPADGDDFKQTNSTSLKARNKIVAMVV IPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGASAAERRRLTCGPTLAASS ESLADDTTSSPPTPKPSKKTKLETDPLMEQLNRKLEAIKEES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gI |
Synonyms | gI; 73; Envelope glycoprotein I |
UniProt ID | Q6DLD8 |
◆ Native Proteins | ||
Chitin-001C | Native Crawfish Chitin | +Inquiry |
CAT-21H | Native Human Catalase Protein | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDR2-001HCL | Recombinant Human DDR2 cell lysate | +Inquiry |
AKR1A1-8932HCL | Recombinant Human AKR1A1 293 Cell Lysate | +Inquiry |
FAM119A-6444HCL | Recombinant Human FAM119A 293 Cell Lysate | +Inquiry |
HIST1H3G-5529HCL | Recombinant Human HIST1H3G 293 Cell Lysate | +Inquiry |
RG9MTD1-2392HCL | Recombinant Human RG9MTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gI Products
Required fields are marked with *
My Review for All gI Products
Required fields are marked with *
0
Inquiry Basket