Recombinant Full Length Equine Herpesvirus 1 Envelope Glycoprotein I(Gi) Protein, His-Tagged
Cat.No. : | RFL11061EF |
Product Overview : | Recombinant Full Length Equine herpesvirus 1 Envelope glycoprotein I(GI) Protein (P68329) (23-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EHV1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-424) |
Form : | Lyophilized powder |
AA Sequence : | IIYRGEHMSMYLNASSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYSSV CYTVIQTISYESCPRVANNAFRSCLHKTSKHYHDYFRVNASVETNVLLNITKPQPTDSGA YILRVKLDHAPTADVFGVSAFVYDLKSKTVPDPMPTTQTVEPTTSYVSTPTYDYTDDVTT ETESTSTSTQQAMTSTQTPSATWGTQLTTELPTNETVVIGQEALLCHWFQPSTRVPTLYL HLLGRTGNLPEDVLLVEDSEFLRTTSPAHRPSASPADGDDFKQTNSTSLKARNKIVAMVV IPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGASAAERRRLTCGPTLAASS ESLADDTTSSPPTPKPSKKTKLETDPLMEQLNRKLEAIKEES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gI |
Synonyms | gI; Envelope glycoprotein I; gI |
UniProt ID | P68329 |
◆ Recombinant Proteins | ||
HNMT-2878R | Recombinant Rat HNMT Protein | +Inquiry |
YCXB-3005B | Recombinant Bacillus subtilis YCXB protein, His-tagged | +Inquiry |
PLTP-3660W | Recombinant Wheat PLTP protein, His-SUMO-tagged | +Inquiry |
RFL25225SF | Recombinant Full Length Magnesium Transport Protein Cora(Cora) Protein, His-Tagged | +Inquiry |
TRIM69-5941R | Recombinant Rat TRIM69 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOC1-27330TH | Native Human APOC1 | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
F10-5392M | Active Native Mouse Coagulation Factor X | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK1G-506HCL | Recombinant Human CAMK1G cell lysate | +Inquiry |
HA-2345HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
AMICA1-2634HCL | Recombinant Human AMICA1 cell lysate | +Inquiry |
LFNG-983HCL | Recombinant Human LFNG cell lysate | +Inquiry |
Stomach-63H | Human Stomach Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gI Products
Required fields are marked with *
My Review for All gI Products
Required fields are marked with *
0
Inquiry Basket