Recombinant Full Length Equine Herpesvirus 1 Envelope Glycoprotein D(Gd) Protein, His-Tagged
Cat.No. : | RFL3165EF |
Product Overview : | Recombinant Full Length Equine herpesvirus 1 Envelope glycoprotein D(gD) Protein (P68327) (20-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EHV1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-452) |
Form : | Lyophilized powder |
AA Sequence : | TQKLSLGLYNQWWRVCRSVPPPWYVFFNKRSMSTFKLMMDGRLVFAMAIAILSVVLSCGT CEKAKRAVRGRQDRPKEFPPPRYNYTILTRYNATALASPFINDQVKNVDLRIVTATRPCE MIALIAKTNIDSILKELAAAQKTYSARLTWFKIMPTCATPIHDVSYMKCNPKLSFAMCDE RSDILWQASLITMAAETDDELGLVLAAPAHSASGLYRRVIEIDGRRIYTDFSVTIPSERC PIAFEQNFGNPDRCKTPEQYSRGEVFTRRFLGEFNFPQGEHMTWLKFWFVYDGGNLPVQF YEAQAFARPVPPDNHPGFDSVESEITQNKTDPKPGQADPKPNQPFKWPSIKHLAPRLDEV DEVIEPVTKPPKTSKSNSTFVGISVGLGIAGLVLVGVILYVCLRRKKELKKSAQNGLTRL RSTFKDVKYTQLP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gD |
Synonyms | gD; GP17/18; Envelope glycoprotein D; gD; Glycoprotein 17/18 |
UniProt ID | P68327 |
◆ Recombinant Proteins | ||
RNH1-30985TH | Recombinant Human RNH1 | +Inquiry |
Enkd1-203M | Recombinant Mouse Enkd1 Protein, MYC/DDK-tagged | +Inquiry |
MRPL20-1087H | Recombinant Human MRPL20 | +Inquiry |
PIP4K2B-30967TH | Recombinant Human PIP4K2B | +Inquiry |
IL16-2842H | Recombinant Human IL16 Protein (Met1-Val433), N-His tagged | +Inquiry |
◆ Native Proteins | ||
Plg-5465R | Native Rat Plasminogen | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POPDC2-3008HCL | Recombinant Human POPDC2 293 Cell Lysate | +Inquiry |
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
SLC39A2-1721HCL | Recombinant Human SLC39A2 293 Cell Lysate | +Inquiry |
SRGAP3-631HCL | Recombinant Human SRGAP3 lysate | +Inquiry |
SASS6-1562HCL | Recombinant Human SASS6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gD Products
Required fields are marked with *
My Review for All gD Products
Required fields are marked with *
0
Inquiry Basket