Recombinant Full Length Epstein-Barr Virus Protein Bdlf2(Bdlf2) Protein, His-Tagged
Cat.No. : | RFL18015EF |
Product Overview : | Recombinant Full Length Epstein-Barr virus Protein BDLF2(BDLF2) Protein (Q3KSQ7) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MVDEQVAVEHGTVSHTISREEDGVVHERRVLASGERVEVFYKAPAPRPREGRASTFHDFT VPAAAAVPGPEPEPEPHPAMPIHANGGGETKTNTQDQNQNQTTRARTNAKAEERTAEMDD TMASSGGQRGAPISADLLSLSSLTGRMAAMAPSWMKSEVCGERMRFKEDVYDGEAETLAE PPRCFMLSFVFIYYCCYLAFLALLAFGFNPLFLPSFMPVGAKVLRGKGRDFGVPLSYGCP TNPFCKVYTLIPAVVINNVTYYPNNTDSLGGHGGFEAAALHVAALFESGCPNLQAVTNRN RTFNVTRASGRVERRLVQDMQRVLASAVVVMHHHCHYETYYVFDGVGPEFGTIPTPSFKD VLAFRPSLVTNCTAPLKTSVKGPNWSGAAGGMKRKQCRVDRLTDRSFPAYLEEVMYVMVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BDLF2 |
Synonyms | BDLF2; Protein BDLF2 |
UniProt ID | Q3KSQ7 |
◆ Recombinant Proteins | ||
GP9-2342H | Recombinant Human GP9 Protein (Thr17-Gly147), His tagged | +Inquiry |
Fga-1547R | Recombinant Rat Fga protein, His-tagged | +Inquiry |
RSPO1-2943H | Recombinant Human RSPO1 protein, For Organoid Culture | +Inquiry |
OLFR473-6358M | Recombinant Mouse OLFR473 Protein, His (Fc)-Avi-tagged | +Inquiry |
YAP1-5533H | Recombinant Human YAP1 Protein | +Inquiry |
◆ Native Proteins | ||
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRZB-873HCL | Recombinant Human FRZB cell lysate | +Inquiry |
NR2F6-3709HCL | Recombinant Human NR2F6 293 Cell Lysate | +Inquiry |
C10orf46-197HCL | Recombinant Human C10orf46 cell lysate | +Inquiry |
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
IFI27L2-5294HCL | Recombinant Human IFI27L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BDLF2 Products
Required fields are marked with *
My Review for All BDLF2 Products
Required fields are marked with *
0
Inquiry Basket