Recombinant Full Length Epstein-Barr Virus Protein Bdlf2 (Bdlf2) Protein, His-Tagged
Cat.No. : | RFL34065EF |
Product Overview : | Recombinant Full Length Epstein-Barr virus Protein BDLF2 (BDLF2) Protein (P03225) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MVDEQVAVEHGTVSHTISREEDGVVHERRVLASGERVEVFYKAPAPRPREGRASTFHDFT VPAAAAVPGPEPEPEPHPPMPIHANGGGETKTNTQDQNQNQTTRTRTNAKAEERTAEMDD TMASSGGQRGAPISADLLSLSSLTGRMAAMAPSWMKSEVCGERMRFKEDVYDGEAETLAE PPRCFMLSFVFIYYCCYLAFLALLAFGFNPLFLPSFMPVGAKVLRGKGRDFGVPLSYGCP TNPFCKVYTLIPAVVINNVTYYPNNTDSHGGHGGFEAAALHVAALFESGCPNLQAVTNRN RTFNVTRASGRVERRLVQDMQRVLASAVVVMHHHCHYETYYVFDGVGPEFGTIPTPCFKD VLAFRPSLVTNCTAPLKTSVKGPNWSGAAGGMKRKQCRVDRLTDRSFPAYLEEVMYVMVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BDLF2 |
Synonyms | BDLF2; Protein BDLF2 |
UniProt ID | P03225 |
◆ Recombinant Proteins | ||
LGALS3-228H | Recombinant Active Human LGALS3 Protein, His-tagged(N-ter) | +Inquiry |
Igfbp6-347R | Recombinant Rat Igfbp6 Protein, His-tagged | +Inquiry |
MAGOH-7655H | Recombinant Human MAGOH protein, His-tagged | +Inquiry |
FDH1-1494C | Recombinant Candida boidinii FDH1 Protein (M1-K364) | +Inquiry |
CA4-0240H | Recombinant Human CA4 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-499C | Chicken Testis Lysate, Total Protein | +Inquiry |
DENND2A-6977HCL | Recombinant Human DENND2A 293 Cell Lysate | +Inquiry |
NVL-1237HCL | Recombinant Human NVL cell lysate | +Inquiry |
CNTN3-3033HCL | Recombinant Human CNTN3 cell lysate | +Inquiry |
TMSL3-902HCL | Recombinant Human TMSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDLF2 Products
Required fields are marked with *
My Review for All BDLF2 Products
Required fields are marked with *
0
Inquiry Basket