Recombinant Full Length Enterobacteria Phage If1 Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL12185EF |
Product Overview : | Recombinant Full Length Enterobacteria phage If1 Attachment protein G3P(III) Protein (O80297) (17-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage If1 (Bacteriophage If1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-460) |
Form : | Lyophilized powder |
AA Sequence : | ATTDAECLSKPAFDGTLSNVWKEGDSRYANFENCIYELSGIGIGYDNDTSCNGHWTPVRA ADGSGNGGDDNSSGGGSNGDSGNNSTPDTVTPGQTVNLPSDLSTLSIPANVVKSDSIGSQ FSLYTNASCTMCSGYYLSNNADSIAIANITETVKADYNQPDMWFEQTDSDGNHVKILQNS YKAVSYNVESKQSDVNNPTYINYSYSVNVKQVSYDTSNVCIMNWETFQNKCDASRAVLIT DTVTPSYSRNITIQSNINYQGSNGSGGSGGSGGSGNDGGGTGNNGNGTGDFDYVKMANAN KDALTESFDLSALQADTGASLDGSVQGTLDSLSGFSDSIGGLVGNGSAISGEFAGSSAAM NAIGEGDKSPLLDSLSFLKDGLFPALPEFKQCTPFVFAPGKEYEFIIECKYIDMFKGIFA FILYFWTFVTVYDSFSGILRKGRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | O80297 |
◆ Native Proteins | ||
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebellum-67H | Human Cerebellum (RT) Membrane Lysate | +Inquiry |
NNT-3777HCL | Recombinant Human NNT 293 Cell Lysate | +Inquiry |
IRS4-5157HCL | Recombinant Human IRS4 293 Cell Lysate | +Inquiry |
MYT1-1163HCL | Recombinant Human MYT1 cell lysate | +Inquiry |
CMTM1-371HCL | Recombinant Human CMTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket