Recombinant Full Length Enterobacteria Phage Fd Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL25536EF |
Product Overview : | Recombinant Full Length Enterobacteria phage fd Attachment protein G3P(III) Protein (P03661) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage fd (Bacteriophage fd) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPI GLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPAN PNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAY WNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSE GGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAID GFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPYVFG AGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | P03661 |
◆ Recombinant Proteins | ||
H3F3A-3013H | Recombinant Human H3F3A protein, His-SUMO-tagged | +Inquiry |
MPHOSPH10-2632R | Recombinant Rhesus Macaque MPHOSPH10 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIKFYVE-01H | Recombinant Human PIKFYVE Protein, His tagged | +Inquiry |
KAT2B-1081H | Active Recombinant Human K (lysine) Acetyltransferase 2B | +Inquiry |
Fasn-3277MFL | Recombinant Full Length Mouse Fasn protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
LEP-27641TH | Native Human LEP | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
KAT5-5089HCL | Recombinant Human KAT5 293 Cell Lysate | +Inquiry |
Heart Ventricle-220H | Human Heart Ventricle (LT) Lysate | +Inquiry |
HA-748HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
PDLIM3-1324HCL | Recombinant Human PDLIM3 cell lysate | +Inquiry |
HA-1928HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket