Recombinant Full Length Enterobacteria Phage F1 Gene 1 Protein(I) Protein, His-Tagged
Cat.No. : | RFL33387EF |
Product Overview : | Recombinant Full Length Enterobacteria phage f1 Gene 1 protein(I) Protein (P03657) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage f1 (Bacteriophage f1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MAVYFVTGKLGSGKTLVSVGKIQDKIVAGCKIATNLDLRLQNLPQVGRFAKTPRVLRIPD KPSISDLLAIGRGNDSYDENKNGLLVLDECGTWFNTRSWNDKERQPIIDWFLHARKLGWD IIFLVQDLSIVDKQARSALAENVVYCRRLDRITLPFVGTLYSLITGSKMPLPKLHVGVVK YGDSQLSPTVERWLYTGKNLYNAYDTKQAFSSNYDSGVYSYLTPYLSHGRYFKPLNLGQK MKLTKIYLKKFSRVLCLAIGFASAFTYSYITQPKPEVKKVVSQTYDFDKFTIDSSQRLNL SYRYVFKDSKGKLINSDDLQKQGYSLTYIDLCTVSIKKGNSNEIVKCN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | I |
Synonyms | I; Gene 1 protein; G1P |
UniProt ID | P03657 |
◆ Recombinant Proteins | ||
GGN-5234HF | Recombinant Full Length Human GGN Protein, GST-tagged | +Inquiry |
ANXA7-5540H | Recombinant Human Annexin A7, His-tagged | +Inquiry |
Rbp3-514R | Recombinant Rat Rbp3 Protein, His-tagged | +Inquiry |
RFL26328DF | Recombinant Full Length Drosophila Ambigua Nadh-Ubiquinone Oxidoreductase Chain 1(Mt:Nd1) Protein, His-Tagged | +Inquiry |
RAB24-31280TH | Recombinant Human RAB24, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-46H | Native Human MMP-2 | +Inquiry |
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIAS4-3201HCL | Recombinant Human PIAS4 293 Cell Lysate | +Inquiry |
P4HA2-3481HCL | Recombinant Human P4HA2 293 Cell Lysate | +Inquiry |
CAPSL-7854HCL | Recombinant Human CAPSL 293 Cell Lysate | +Inquiry |
IFNA7-1703HCL | Recombinant Human IFNA7 cell lysate | +Inquiry |
HSF4-821HCL | Recombinant Human HSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All I Products
Required fields are marked with *
My Review for All I Products
Required fields are marked with *
0
Inquiry Basket