Recombinant Full Length Enterobacteria Phage F1 Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL12452EF |
Product Overview : | Recombinant Full Length Enterobacteria phage f1 Attachment protein G3P(III) Protein (P69169) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage f1 (Bacteriophage f1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPI GLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPAN PNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAY WNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSE GGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAID GFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFG AGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | P69169 |
◆ Recombinant Proteins | ||
STK10-555H | Recombinant Human Serine/Threonine Kinase 10, His-tagged | +Inquiry |
Ypel4-7036M | Recombinant Mouse Ypel4 Protein, Myc/DDK-tagged | +Inquiry |
ARFGAP3-575H | Recombinant Human ARFGAP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPP1R16A-13225M | Recombinant Mouse PPP1R16A Protein | +Inquiry |
KLHL2-1162H | Recombinant Human KLHL2 protein(Met1-Pro306), GST-tagged | +Inquiry |
◆ Native Proteins | ||
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-146R | Rat Spleen Tissue Lysate | +Inquiry |
CCDC87-7744HCL | Recombinant Human CCDC87 293 Cell Lysate | +Inquiry |
GLI3-5904HCL | Recombinant Human GLI3 293 Cell Lysate | +Inquiry |
C1orf65-8148HCL | Recombinant Human C1orf65 293 Cell Lysate | +Inquiry |
AJUBA-5097HCL | Recombinant Human JUB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket