Recombinant Full Length Enterobacter Sp. Upf0283 Membrane Protein Ent638_2153 (Ent638_2153) Protein, His-Tagged
Cat.No. : | RFL20345EF |
Product Overview : | Recombinant Full Length Enterobacter sp. UPF0283 membrane protein Ent638_2153 (Ent638_2153) Protein (A4WAU8) (1-349aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-349) |
Form : | Lyophilized powder |
AA Sequence : | MTEPLKPRIDFPGTLEQERAEAFKAAQAFSGPQAENFAPAVAEELLSDEGPAEAVVEAAL RPKRSLWRKMVTAGLTLFGISVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVA TEWRRLWRLRQRAHERDEARDLFHSHATGKGRAFCEKLASQAGIDQSHPALQRWYAAIHE TQSDREIVSLYASIVQPVLDSQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIARLYGIELGYYSRLRLFRLVLLNMAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWLNDDKPRLGDFRRELIGQLKETLSKKPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ent638_2153 |
Synonyms | Ent638_2153; UPF0283 membrane protein Ent638_2153 |
UniProt ID | A4WAU8 |
◆ Recombinant Proteins | ||
SAOUHSC-01000-3682S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01000 protein, His-tagged | +Inquiry |
DENND2DA-4664Z | Recombinant Zebrafish DENND2DA | +Inquiry |
CD14-124H | Recombinant Human CD14 Protein, Fc-tagged | +Inquiry |
TLR13-16823M | Recombinant Mouse TLR13 Protein | +Inquiry |
CD59-0836H | Recombinant Human CD59 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
KLK3-386H | Native Human Prostate Specific Antigen | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2B5-6669HCL | Recombinant Human EIF2B5 293 Cell Lysate | +Inquiry |
MIS12-4308HCL | Recombinant Human MIS12 293 Cell Lysate | +Inquiry |
Heart Ventricle-223H | Human Heart Ventricle (RT) Lysate | +Inquiry |
FUT7-6112HCL | Recombinant Human FUT7 293 Cell Lysate | +Inquiry |
STK38L-1399HCL | Recombinant Human STK38L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ent638_2153 Products
Required fields are marked with *
My Review for All Ent638_2153 Products
Required fields are marked with *
0
Inquiry Basket