Recombinant Full Length Encephalitozoon Cuniculi Uncharacterized Membrane Protein Ecu07_0530(Ecu07_0530) Protein, His-Tagged
Cat.No. : | RFL31591EF |
Product Overview : | Recombinant Full Length Encephalitozoon cuniculi Uncharacterized membrane protein ECU07_0530(ECU07_0530) Protein (Q8SV25) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Encephalitozoon cuniculi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MYCLRAAGGRLWKKEPIKFYYKYPFARRGKMRAETSSGSKRTFKTLRTGFLGLVGVIAVY YALLFIFGIKYLNPQYYGSYFYAWRVNFADKLMTHGRYKLIKKNEHPETEDRKRFYRISQ DKEGPYLIRFDRPEHFPRGHEHQFSLNFPAYEDFLKVRERFIVESEGLQENMKLEHSDLM EQMKKEKGGLFFASYSGKSVEEMMRILFPNNNADRNPWFDVSNILIRAVSRIMSQDEKDR EGYLFDGSEVGDDLMKDIREGLDALDRSAGDGDVLLSEKISDADIKNFFINNGRVSGTPQ ETFAYSRLYYLFNFLTAGIEFKSERLAELRGDGESSNEFREARMDYVANVFARIFASIYP NQHKKDVSNIGVLEKVRNYYSPKMTVDPEKEVDDADLELVRESFSRSSRISA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ECU07_0530 |
Synonyms | ECU07_0530; Uncharacterized membrane protein ECU07_0530 |
UniProt ID | Q8SV25 |
◆ Recombinant Proteins | ||
gC-574H | Recombinant Human herpesvirus 2 (strain HG52) gC protein, His-tagged | +Inquiry |
PEDINA-P27-4585S | Recombinant Staphylococcus aureus (strain: E-1) PEDINA_P27 protein, His-tagged | +Inquiry |
EEF2K-2018R | Recombinant Rat EEF2K Protein | +Inquiry |
RFL36171AF | Recombinant Full Length Arabidopsis Thaliana Probable Cyclic Nucleotide-Gated Ion Channel 5(Cngc5) Protein, His-Tagged | +Inquiry |
B3GNT4-2242M | Recombinant Mouse B3GNT4 Protein | +Inquiry |
◆ Native Proteins | ||
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
IgA-241F | Native Ferret Immunoglobulin A | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
IgM-01C | Native Cow IgM Protein | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPG-4724HCL | Recombinant Human LIPG 293 Cell Lysate | +Inquiry |
SPPL2B-1500HCL | Recombinant Human SPPL2B 293 Cell Lysate | +Inquiry |
CCDC96-165HCL | Recombinant Human CCDC96 lysate | +Inquiry |
YIPF2-738HCL | Recombinant Human YIPF2 lysate | +Inquiry |
XPNPEP2-1901HCL | Recombinant Human XPNPEP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECU07_0530 Products
Required fields are marked with *
My Review for All ECU07_0530 Products
Required fields are marked with *
0
Inquiry Basket