Recombinant Full Length Encephalitozoon Cuniculi Uncharacterized Membrane Protein Ecu04_1630(Ecu04_1630) Protein, His-Tagged
Cat.No. : | RFL31961EF |
Product Overview : | Recombinant Full Length Encephalitozoon cuniculi Uncharacterized membrane protein ECU04_1630(ECU04_1630) Protein (Q8SVP6) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Encephalitozoon cuniculi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MDAVAGPSVFVKYRRFRSLFVMQMRLWKKEPIKFYYKYSFARRGKMRAETSSGSKRTFKT LRTGFLGLVGVIAVYYALLFIFGIKYLNPQYYGSYFYAWRVNFADKLMTHGRYKLIKKNE HPETEDRKRFYRISQDKEGPYLIRFDRPEHFPRGHEHQFSLNFPAYEDFLKVRERFIVES EGLQENMKLEHSDLMEQMKKEKGGLFFASYSGKSVEEMMRILFPNNNADRNPWFDVSNIL IRAVSRIMSQDEKDREGYLFDGSEVGDDLMKDIREGLDALDRSAGDGDVLLSEKISDADI KNFFINNGRVSGTPQETFAYSRLYYLFNFLTAGIEFKSERLAELRGDGESSNEFREARMD YVANVFARIFASIYPNQHKKDVSNIGVLEKVRNYYSPKMTVDPEKEVDDADLELVRESFS RSSRISA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ECU04_1630 |
Synonyms | ECU04_1630; Uncharacterized membrane protein ECU04_1630 |
UniProt ID | Q8SVP6 |
◆ Recombinant Proteins | ||
HAAO-1775Z | Recombinant Zebrafish HAAO | +Inquiry |
TNFRSF8-6201R | Recombinant Rat TNFRSF8 Protein | +Inquiry |
CHMP4C-11188H | Recombinant Human CHMP4C, His-tagged | +Inquiry |
PREPL-7077M | Recombinant Mouse PREPL Protein, His (Fc)-Avi-tagged | +Inquiry |
PIK3R2-178H | Recombinant Human PIK3R2 protein(75-125aa), His-GST-tagged | +Inquiry |
◆ Native Proteins | ||
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FMR1NB-6178HCL | Recombinant Human FMR1NB 293 Cell Lysate | +Inquiry |
CACNA2D3-7904HCL | Recombinant Human CACNA2D3 293 Cell Lysate | +Inquiry |
TRIM74-1836HCL | Recombinant Human TRIM74 cell lysate | +Inquiry |
DENR-6975HCL | Recombinant Human DENR 293 Cell Lysate | +Inquiry |
GSTCD-5715HCL | Recombinant Human GSTCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ECU04_1630 Products
Required fields are marked with *
My Review for All ECU04_1630 Products
Required fields are marked with *
0
Inquiry Basket