Recombinant Full Length Emericella Nidulans Uncharacterized Rhomboid Protein An10929 (An10929) Protein, His-Tagged
Cat.No. : | RFL9106EF |
Product Overview : | Recombinant Full Length Emericella nidulans Uncharacterized rhomboid protein AN10929 (AN10929) Protein (C8VCL5) (1-503aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-503) |
Form : | Lyophilized powder |
AA Sequence : | MAAQSYYNGAYNSPPAYEQHDHTSDQFNRVSPRPSPSPVAYNNAPYYQSDDPHDPNSLRY SQQSIGSDNGAYVAGGRINEHDQYAENIPLKSANPYGNDHPPQPWMQQPTHYAPDPGMME PQVPMRQKKKGFFQKKIAYVTYILTIAQIIVFIVELVKMGQLTGSPIQTKPQFNPMVGPS AYVQINMGARYTPCMKNVPGVQNATQQVLFPCPNATTTDSDCSLSELCGFDGVPNPHPGG SLDDKPAPDQWFRFIIPMFLHSGFVHIGFNLLVQMTMGADMERMIGWWRYGLVYLSSGIW GFVLGGNYAGQGEASCGCSGALFGILALFVLDLLYGWNDRQNPWVELIIMVLGIAVSFVL GLLPGLDNFSHLGGFTMGLALGLCVMRSPNALRERIGLARSPYVAMSGGVAAENADPDQN KTSTGSNIGGLGKFNPKGFFAGRKPLWWAWWLVRLGALVAVLIGFILLIVNFYKYPSSNC SWCYRFSCLPVNGWCDQGNLFSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AN10929 |
Synonyms | AN10929; Uncharacterized rhomboid protein AN10929 |
UniProt ID | C8VCL5 |
◆ Recombinant Proteins | ||
UBE2I-4875R | Recombinant Rhesus Macaque UBE2I Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM66-5834R | Recombinant Rat TMEM66 Protein, His (Fc)-Avi-tagged | +Inquiry |
ponA-1287N | Recombinant N. meningitidis ponA Protein, His-SUMO-tagged | +Inquiry |
YPUI-3123B | Recombinant Bacillus subtilis YPUI protein, His-tagged | +Inquiry |
REEP4-3842R | Recombinant Rhesus monkey REEP4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POSTN-2269MCL | Recombinant Mouse POSTN cell lysate | +Inquiry |
RIMKLB-588HCL | Recombinant Human RIMKLB cell lysate | +Inquiry |
ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
THBS4-1774HCL | Recombinant Human THBS4 cell lysate | +Inquiry |
MRPL21-4188HCL | Recombinant Human MRPL21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AN10929 Products
Required fields are marked with *
My Review for All AN10929 Products
Required fields are marked with *
0
Inquiry Basket