Recombinant Full Length Emericella Nidulans Gpi Mannosyltransferase 4(Smp3) Protein, His-Tagged
Cat.No. : | RFL24884EF |
Product Overview : | Recombinant Full Length Emericella nidulans GPI mannosyltransferase 4(smp3) Protein (Q5BAX7) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MWRRTYLLLLLIRAYFALSPSYIHPDEHFQGLEVFAGRILSYPSRLPWEFTSERPIRSVF PLYPIYGVPISLLKWFYTETGTESPPAELVYYVVRGVMFLLSFVLEDWAVHDLVPLPRHR RVALVLVASSYVTWTHQTHTFSNSLETLLVAWGLVLINRIIDNKRRSSLFSCAILSFICV AGIFNRITFPAFLVLSLGLVVYNFPRRPLSFFSLVGFGLVFFCIAVFADTTFYKPSASFA DVLRSPVITPLNNLLYNTDNSNLALHGLHPHYNHFLVNLPQLLGPALVAMVLQAYNRGFI ASWFKNLRAASALSATAMLSIFPHQEPRFLIPCVPLLLSCLQVRKSRIFLGAWVIFNATL GFLMGVYHQGGVVSTQLAVPSVISTTTSLWHESLKGTQSLFATVVWWKTYSPPLWLLGDN STLNLNIDTRDLMGKPGSEMVKELERLVPTCGSKQKSTELTSSLEQPDAVFVVAPKSVTF LDQFLAPQSPDSSLELLELWSYKKHISLDDLDFGSDGVLPTMKRVIGRRGLGVWLAQRPG CRAIDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | smp3 |
Synonyms | smp3; AN2303; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV |
UniProt ID | Q5BAX7 |
◆ Recombinant Proteins | ||
RFL19761AF | Recombinant Full Length Aeromonas Punctata Upf0126 Membrane Protein(Yads) Protein, His-Tagged | +Inquiry |
H2-KE6-7441M | Recombinant Mouse H2-KE6 Protein | +Inquiry |
Eng-638R | Active Recombinant Rat Eng, Fc Chimera | +Inquiry |
UBLCP1-468Z | Recombinant Zebrafish UBLCP1 | +Inquiry |
CLIC2-682Z | Recombinant Zebrafish CLIC2 | +Inquiry |
◆ Native Proteins | ||
PTA-23B | Active Native Bacillus stearothermophilus Phosphotransacetylase | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
IREB2-5169HCL | Recombinant Human IREB2 293 Cell Lysate | +Inquiry |
IL21R-2019HCL | Recombinant Human IL21R cell lysate | +Inquiry |
Adrenal-421S | Sheep Adrenal Lysate, Total Protein | +Inquiry |
RAD51D-2553HCL | Recombinant Human RAD51L3 293 Cell Lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All smp3 Products
Required fields are marked with *
My Review for All smp3 Products
Required fields are marked with *
0
Inquiry Basket