Recombinant Full Length Emericella Nidulans 3-Ketodihydrosphingosine Reductase Tsc10(Tsc10) Protein, His-Tagged
Cat.No. : | RFL12207EF |
Product Overview : | Recombinant Full Length Emericella nidulans 3-ketodihydrosphingosine reductase tsc10(tsc10) Protein (Q5BE65) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MHPSLPSIIYDASPTALGISAVFGALFFYTLVKMFGFLARENQFVVEGRTVVITGGSEGM GKAVACQLAQKGANIVIVARTLQKLEEAIEAIKGSAANVNKQRFHYISADLTKPEECERI MTEVTEWNDGMPPDIVWCCAGYCTPGYFVETSVQTLKDQMDTVYWTAANTAHAILRKWLV PINPSHQRPLPRRHLIFTCSTLAFVPIAGYAPYSPAKAAMRALSDTLCQEIEVYNGSRAS KERARATPADVKIHTVFPMGILSPGFDNEQQIKPALTKQLESADKPQTPKEVARIAIEAI ERGEYLITTMFVGDVMKGAALGPSPRNSWFRDTCTGWLSNLLFLGVVPDLRKQAFNWGAK NGVPTSPSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tsc10 |
Synonyms | tsc10; AN1165; 3-ketodihydrosphingosine reductase tsc10; 3-dehydrosphinganine reductase; KDS reductase |
UniProt ID | Q5BE65 |
◆ Recombinant Proteins | ||
DEFB4-1838R | Recombinant Rat DEFB4 Protein | +Inquiry |
GFRAL-001H | Recombinant Human GFRAL Protein, 19-351, N-Fc tagged | +Inquiry |
PITX3-12851M | Recombinant Mouse PITX3 Protein | +Inquiry |
TIMP1-3194H | Active Recombinant Human TIMP1 protein | +Inquiry |
FER-4073H | Active Recombinant Human FER Protein, GST/His-tagged | +Inquiry |
◆ Native Proteins | ||
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
SERPINA3-8008H | Native Human Serum Alpha 1-AntiChymoTrypsin | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF6-932HCL | Recombinant Human KIF6 cell lysate | +Inquiry |
LAT2-4814HCL | Recombinant Human LAT2 293 Cell Lysate | +Inquiry |
VSIG4-1092HCL | Recombinant Human VSIG4 cell lysate | +Inquiry |
GTF2F1-5700HCL | Recombinant Human GTF2F1 293 Cell Lysate | +Inquiry |
OCEL1-3607HCL | Recombinant Human OCEL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tsc10 Products
Required fields are marked with *
My Review for All tsc10 Products
Required fields are marked with *
0
Inquiry Basket