Recombinant Full Length Electron Transport Complex Protein Rnfg(Rnfg) Protein, His-Tagged
Cat.No. : | RFL15157SF |
Product Overview : | Recombinant Full Length Electron transport complex protein RnfG(rnfG) Protein (Q8Z6Q7) (1-206aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-206) |
Form : | Lyophilized powder |
AA Sequence : | MLKTIRKHGITLALFAAGSTGLTAVINQMTKSTIHEQALQQQHALFDQVLPPDRYNNNLQ ESCYLVDAPALGKGTHRVFIARKDDKPVAAIIEATAPDGYSGAIQLIVGADFNGTILGTR VTEHHETPGLGDKIERRLSDWITHFSGKTISGENDTHWAVKKDGGDFDQFTGATITPRAV VNAVKRAGLYAESLPAQLPHLTACGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rsxG |
Synonyms | rsxG; STY1667; t1323; Ion-translocating oxidoreductase complex subunit G; Rsx electron transport complex subunit G |
UniProt ID | Q8Z6Q7 |
◆ Native Proteins | ||
ADVag-281V | Active Native ADV Protein | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCH1-2723HCL | Recombinant Human PTCH1 293 Cell Lysate | +Inquiry |
GNG7-5850HCL | Recombinant Human GNG7 293 Cell Lysate | +Inquiry |
TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
CXorf56-7154HCL | Recombinant Human CXorf56 293 Cell Lysate | +Inquiry |
IRX6-875HCL | Recombinant Human IRX6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rsxG Products
Required fields are marked with *
My Review for All rsxG Products
Required fields are marked with *
0
Inquiry Basket