Recombinant Full Length Electron Transport Complex Protein Rnfg(Rnfg) Protein, His-Tagged
Cat.No. : | RFL35901YF |
Product Overview : | Recombinant Full Length Electron transport complex protein RnfG(rnfG) Protein (Q8ZED3) (1-209aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-209) |
Form : | Lyophilized powder |
AA Sequence : | MLKTMRRHGITLALFAAGATGLTAVVNSLTENTIAHQAALQQKALLDQVVPAENYDNDMQ AECYVVTDSALGNMAPHRLYLARKGNQPVAAAIETTAPDGYSGAIQLLVGADFHGNVLGS RVIEHHETPGLGDKIDIRISDWINHFSGQHVTGDDDKRWAVKKDGGSFDQFTGATITPRA VVRAVKNAALYLQTLPPQLSRLPSCGEDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YPO2241 |
Synonyms | rnfG; YPO2241; y2082; YP_2039; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G |
UniProt ID | Q8ZED3 |
◆ Native Proteins | ||
Fxa-281B | Active Native Bovine Factor Xa | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
UGGT2-1878HCL | Recombinant Human UGGT2 cell lysate | +Inquiry |
DRD2-6817HCL | Recombinant Human DRD2 293 Cell Lysate | +Inquiry |
Corpus Callosum-18H | Human Corpus Callosum Tissue Lysate | +Inquiry |
ASS1-8639HCL | Recombinant Human ASS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YPO2241 Products
Required fields are marked with *
My Review for All YPO2241 Products
Required fields are marked with *
0
Inquiry Basket