Recombinant Full Length Ectopic P Granules Protein 3(Epg-3) Protein, His-Tagged
Cat.No. : | RFL4144CF |
Product Overview : | Recombinant Full Length Ectopic P granules protein 3(epg-3) Protein (Q9XWU8) (1-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-458) |
Form : | Lyophilized powder |
AA Sequence : | MAKKQKKSTEKSERTVEFKEPPKPANSEERLKPAGRGMKPSPSQNTLNRMERETIVFWRR PHIVIPYALMEIAHLAVELFFKILAHKTVLLLTAISIGLAVYGYHAPGAHQEHVQTIEKH ILWWSWWVLLGVLSSIGLGSGLHTFLIYLGPHIAAVTMAAYECQSLDFPQPPYPESIQCP STKSSIAVTFWQIVAKVRVESLLWGAGTALGELPPYFMARAARISGQEPDDEEYREFLEL MNADKESDADQKLSIVERAKSWVEHNIHRLGFPGILLFASIPNPLFDLAGITCGHFLVPF WSFFGATLIGKALVKMHVQMGFVILAFSDHHAENFVKILEKIPAVGPYIRQPISDLLEKQ RKALHKTPGEHSEQSTSYLAWGLSLMVTFMILFFFLSIVNSLAKDYHKRLWERKRRQNKD LIDEENQSFEEEEEEAVTPPSSCPLLLSDGFEGVVVKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | epg-3 |
Synonyms | epg-3; Y37D8A.22; Ectopic P granules protein 3 |
UniProt ID | Q9XWU8 |
◆ Recombinant Proteins | ||
iga-1207H | Recombinant Haemophilus influenzae iga Protein (Ala26-Pro1008), N-GST tagged | +Inquiry |
HISS-2578B | Recombinant Bacillus subtilis HISS protein, His-tagged | +Inquiry |
ANKRD12-10497Z | Recombinant Zebrafish ANKRD12 | +Inquiry |
H3F3B-1728H | Recombinant Human H3F3B Protein, His-tagged | +Inquiry |
RFL12376AF | Recombinant Full Length Alcelaphine Herpesvirus 1 G-Protein Coupled Receptor A5(A5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRLR-1451MCL | Recombinant Mouse PRLR cell lysate | +Inquiry |
AHCY-8964HCL | Recombinant Human AHCY 293 Cell Lysate | +Inquiry |
SH3BP5L-1869HCL | Recombinant Human SH3BP5L 293 Cell Lysate | +Inquiry |
ATPIF1-8569HCL | Recombinant Human ATPIF1 293 Cell Lysate | +Inquiry |
CDCP1-882CCL | Recombinant Cynomolgus CDCP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All epg-3 Products
Required fields are marked with *
My Review for All epg-3 Products
Required fields are marked with *
0
Inquiry Basket