Recombinant Full Length Drosophila Pseudoobscura Pseudoobscura Opsin Rh1(Ninae) Protein, His-Tagged
Cat.No. : | RFL26966DF |
Product Overview : | Recombinant Full Length Drosophila pseudoobscura pseudoobscura Opsin Rh1(ninaE) Protein (P28678) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MDSFAAVATQLGPHFAALSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIII GMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGP MMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIW CLAPVFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAA VSAHEKAMREQAKKMNVKSLRSSEDADKSAEGKLAKVALVTISLWFMAWTPYLVINCMGL FKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSEA QSQATNSEAESKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ninaE |
Synonyms | ninaE; Rh1; GA18249; Opsin Rh1; Outer R1-R6 photoreceptor cells opsin |
UniProt ID | P28678 |
◆ Recombinant Proteins | ||
NLGN4Y-6715HF | Recombinant Full Length Human NLGN4Y Protein, GST-tagged | +Inquiry |
RFL3062EF | Recombinant Full Length Eisenia Fetida Lysenin Protein, His&Myc-Tagged | +Inquiry |
PRB1-4313R | Recombinant Rat PRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP7A-458H | Recombinant Human ATP7A, Domain 5 | +Inquiry |
RFL31637GF | Recombinant Full Length Geobacter Sp. Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
Protein A-01S | Active Native Staphylococcus aureus Protein A | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCE1-9145HCL | Recombinant Human ABCE1 293 Cell Lysate | +Inquiry |
MRPS16-4149HCL | Recombinant Human MRPS16 293 Cell Lysate | +Inquiry |
AMPK-416HCL | Recombinant Human AMPK cell lysate | +Inquiry |
ATP5C1-8603HCL | Recombinant Human ATP5C1 293 Cell Lysate | +Inquiry |
SPATA3-625HCL | Recombinant Human SPATA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ninaE Products
Required fields are marked with *
My Review for All ninaE Products
Required fields are marked with *
0
Inquiry Basket