Recombinant Full Length Drosophila Melanogaster Transmembrane Gtpase Fzo(Fzo) Protein, His-Tagged
Cat.No. : | RFL19116DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Transmembrane GTPase fzo(fzo) Protein (O18412) (1-718aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-718) |
Form : | Lyophilized powder |
AA Sequence : | MAESDSGESTSSVSSFISSSSSSRLSEFVDAKTELQDIYHDLSNYLSNFLTILEETVLLK DRQMLEHLCAFSSRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTT SCFCQVQANGSNETEHVKVEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSI LDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSR PNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALE ALHIRNGQITNPSGQTQQRYQEFLRFENDFSNCLAVSALKTKFGPHLLSAQKILNQLKST LICPFIEKVSRLIDENKERRANLNAEIEDWLILMQEDREALQYCFEELTEMTQRVGRCVL NDQIKTLIPSSVLSFSQPFHPEFPAQIGQYQRSLCAHLDKLLEDRVLQCLSIPLQRKILD IEKEIGLPIAENSCDWQLIYGLDCQSYMSDFQPDLRFRFSLGFTALWHRLEGNLPLHASP FRIQKLQNGHKKCSPLPPLVNGNHWQMLESLVKSKGSLGTVLLSAMAIRSFNWPIVLILG GLVGSFYIYEYAAWTTAAQERSFKSQYARLLQQRLRSDVQQTVSGFELQLRQHLATVRNC WEAQSNETLNDLNVRTAELTKQIQSMEVLQLSLKKFRDKGQLLASRLGDFQETYLTKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fzo |
Synonyms | fzo; CG4568; Transmembrane GTPase fzo; Protein fuzzy onions |
UniProt ID | O18412 |
◆ Recombinant Proteins | ||
Spike-221V | Active Recombinant COVID-19 Spike RBD (F342L) protein, His-tagged | +Inquiry |
PDSS2-4361R | Recombinant Rat PDSS2 Protein | +Inquiry |
SLC22A7-5120R | Recombinant Rat SLC22A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHA7-697H | Recombinant Human EPH Receptor A7, GST-tagged | +Inquiry |
ruvC-4233E | Recombinant Escherichia coli ruvC protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
HP-200H | Native Human Haptoglobin | +Inquiry |
IgA-247G | Native Guinea Pig Immunoglobulin A | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHCHD2-183HCL | Recombinant Human CHCHD2 lysate | +Inquiry |
DNAJC11-495HCL | Recombinant Human DNAJC11 cell lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
KRTAP10-2-960HCL | Recombinant Human KRTAP10-2 cell lysate | +Inquiry |
NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fzo Products
Required fields are marked with *
My Review for All fzo Products
Required fields are marked with *
0
Inquiry Basket