Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 7A(Or7A) Protein, His-Tagged
Cat.No. : | RFL9337DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 7a(Or7a) Protein (Q9W3I5) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MAVSTRVATKQEVPESRRAFRNLFNCFYALGMQAPDGSRPTTSSTWQRIYACFSVVMYVW QLLLVPTFFVISYRYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNLPLLRRAEHHLAA LDARCREQEEFQLILDAVRFCNYLVWFYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDW QRSQMQFCIQAWIEFLIMNWTCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSGQ VEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINI FIFANTNTKIASIIYLLAVTLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKML LYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIKGMNLGERFNRTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or7a |
Synonyms | Or7a; CG10759; Odorant receptor 7a |
UniProt ID | Q9W3I5 |
◆ Recombinant Proteins | ||
LGALS3-191H | Active Recombinant Human LGALS3 Protein (Ala2-Ile250), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Fars2-8212R | Recombinant Rat Fars2 protein, His & T7-tagged | +Inquiry |
XKDK-2374B | Recombinant Bacillus subtilis XKDK protein, His-tagged | +Inquiry |
SOD1-328H | Recombinant Human SOD1 protein, His/MBP-tagged | +Inquiry |
FGF12-6451C | Recombinant Chicken FGF12 | +Inquiry |
◆ Native Proteins | ||
CTRC-27191TH | Native Human CTRC | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
PTI-603B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACE2-1388MCL | Recombinant Mouse BACE2 cell lysate | +Inquiry |
SkeletalMuscles-470C | Cat Skeletal Muscles Lysate, Total Protein | +Inquiry |
RPS25-2166HCL | Recombinant Human RPS25 293 Cell Lysate | +Inquiry |
PAM-3448HCL | Recombinant Human PAM 293 Cell Lysate | +Inquiry |
SCUBE1-2018HCL | Recombinant Human SCUBE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or7a Products
Required fields are marked with *
My Review for All Or7a Products
Required fields are marked with *
0
Inquiry Basket