Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 74A(Or74A) Protein, His-Tagged
Cat.No. : | RFL11284DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 74a(Or74a) Protein (Q9VVF3) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MSFHRYRPRLPGGELAPMPWPVSLYRVLNHVAWPLEAESGRWTVFLDRLMIFLGFLVFCE HNEVDFHYLIANRQDMDNMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVS EEMEPHLFASIQRQMLATRVNSTVYLLALLNFFLVPVTNVIYHRREMLYKQVYPFDNTQL HFFIPLLVLNFWVGFIITSMLFGELNVMGELMMHLNARYIQLGQDLRRSAQMLLKKSSSL NVAIAYRLNLTHILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGLLCALFFKAFTNPWGN VAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLV TLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSMR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or74a |
Synonyms | Or74a; CG13726; Odorant receptor 74a |
UniProt ID | Q9VVF3 |
◆ Recombinant Proteins | ||
KLK5-5870H | Recombinant Human KLK5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CPPED1-4233H | Recombinant Human CPPED1 Protein, GST-tagged | +Inquiry |
RFL28751AF | Recombinant Full Length Apis Mellifera Ligustica Olfactory Receptor-Like Protein Hba1 Protein, His-Tagged | +Inquiry |
MKNK2-5368H | Active Recombinant Human MKNK2 Protein, GST-tagged | +Inquiry |
POLR3GL-3522R | Recombinant Rhesus monkey POLR3GL Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
CPB-01P | Native Porcine Carboxypeptidase B | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-541E | Equine Lung Lysate, Total Protein | +Inquiry |
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
ADAL-9039HCL | Recombinant Human ADAL 293 Cell Lysate | +Inquiry |
UEVLD-523HCL | Recombinant Human UEVLD 293 Cell Lysate | +Inquiry |
DCTN4-7039HCL | Recombinant Human DCTN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or74a Products
Required fields are marked with *
My Review for All Or74a Products
Required fields are marked with *
0
Inquiry Basket