Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 45A(Or45A) Protein, His-Tagged
Cat.No. : | RFL7139DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 45a(Or45a) Protein (Q9V568) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MDASYFAVQRRALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTR LTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDR YVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYV WGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEKDLNGGDSRLTGFVSRHRIA LDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAIIIQLSSYC YGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFVVDLPLLL WVIRTAGSFLAMLRTFER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or45a |
Synonyms | Or45a; CG1978; Odorant receptor 45a |
UniProt ID | Q9V568 |
◆ Recombinant Proteins | ||
RFL12330EF | Recombinant Full Length Escherichia Coli Potassium-Transporting Atpase B Chain(Kdpb) Protein, His-Tagged | +Inquiry |
FMN2-5934M | Recombinant Mouse FMN2 Protein | +Inquiry |
YARS2-6280R | Recombinant Rat YARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KIAA1804-2400R | Recombinant Rhesus monkey KIAA1804 Protein, His-tagged | +Inquiry |
RFL23396OF | Recombinant Full Length Orconectes Virilis Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PLE-105P | Active Native Porcine Esterase | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
HP-193S | Native Swine Haptoglobin | +Inquiry |
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
ECV-309S | Native Snake ECV- PROTHROMBIN ACTIVATOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT2-3647HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry |
RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
TUBG1-644HCL | Recombinant Human TUBG1 293 Cell Lysate | +Inquiry |
CD209B-2167MCL | Recombinant Mouse CD209B cell lysate | +Inquiry |
HIST1H2BL-5536HCL | Recombinant Human HIST1H2BL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or45a Products
Required fields are marked with *
My Review for All Or45a Products
Required fields are marked with *
0
Inquiry Basket