Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 24A(Or24A) Protein, His-Tagged
Cat.No. : | RFL16773DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 24a(Or24a) Protein (P81913) (1-398aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-398) |
Form : | Lyophilized powder |
AA Sequence : | MLPRFLTASYPMERHYFMVPKFALSLIGFYPEQKRTVLVKLWSFFNFFILTYGCYAEAYY GIHYIPINIATALDALCPVASSILSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLG YKKRFYTLATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLL RLPLYPITYILVHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVCDLLEVENIEKS PSEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFS GLGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVA RAQRVLTIKIPFFSPSLETLTSILRFTGSLIALAKSVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or24a |
Synonyms | Or24a; DOR24D.1; Or24D.1; CG11767; Odorant receptor 24a |
UniProt ID | P81913 |
◆ Recombinant Proteins | ||
SLC13A5-8222M | Recombinant Mouse SLC13A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINB6-5915H | Recombinant Human SERPINB6 Protein (Met1-Pro376), N-His and Trx tagged | +Inquiry |
Epx-905M | Recombinant Mouse Epx Protein, His-tagged | +Inquiry |
Tfrc-6385M | Recombinant Mouse Tfrc Protein, Myc/DDK-tagged | +Inquiry |
HASPIN-4394H | Recombinant Human HASPIN Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ELN-01H | Active Native Human ELN Protein | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
F10-9H | Native Human Factor Xa, Active Site Labeled with Biotin | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX5-3498HCL | Recombinant Human P2RX5 293 Cell Lysate | +Inquiry |
Tonsil-534H | Human Tonsil Cytoplasmic Tumor Lysate | +Inquiry |
DCD-7053HCL | Recombinant Human DCD 293 Cell Lysate | +Inquiry |
MATN2-4449HCL | Recombinant Human MATN2 293 Cell Lysate | +Inquiry |
CCDC6-297HCL | Recombinant Human CCDC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Or24a Products
Required fields are marked with *
My Review for All Or24a Products
Required fields are marked with *
0
Inquiry Basket