Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 19A(Or19A) Protein, His-Tagged
Cat.No. : | RFL2704DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 19a(Or19a) Protein (Q9I816) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MDISKVDSTRALVNHWRIFRIMGIHPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNL LQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDERQIIM AGIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAYLATAMLH TTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHD HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTE TLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPIS MKTFTVMIKGAYTMLTLLNEIRKTSLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or19a |
Synonyms | Or19a; CG18859; Odorant receptor 19a |
UniProt ID | Q9I816 |
◆ Recombinant Proteins | ||
COL28A1-1872HFL | Recombinant Full Length Human COL28A1 Protein, C-Flag-tagged | +Inquiry |
RNPS1-7699M | Recombinant Mouse RNPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCM6L-3148Z | Recombinant Zebrafish MCM6L | +Inquiry |
SMC5-15613M | Recombinant Mouse SMC5 Protein | +Inquiry |
RPRD1A-155H | Recombinant Human RPRD1A, His-tagged | +Inquiry |
◆ Native Proteins | ||
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
LDL-405H | Native Human Low Density Lipoprotein, Acetylated | +Inquiry |
ENO2-8235H | Native Human Brain Neuron Specific Enolase | +Inquiry |
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF6-6237HCL | Recombinant Human FGF6 293 Cell Lysate | +Inquiry |
SPOP-1502HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
NDUFS2-3897HCL | Recombinant Human NDUFS2 293 Cell Lysate | +Inquiry |
KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or19a Products
Required fields are marked with *
My Review for All Or19a Products
Required fields are marked with *
0
Inquiry Basket