Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 10A(Or10A) Protein, His-Tagged
Cat.No. : | RFL16388DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 10a(Or10a) Protein (Q9VYZ1) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MSEWLRFLKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELH AGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERP EQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMT MPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRP YTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMV NLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQR RLVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIALVKSFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or10a |
Synonyms | Or10a; CG17867; Odorant receptor 10a |
UniProt ID | Q9VYZ1 |
◆ Recombinant Proteins | ||
Cmklr2-1087R | Recombinant Rat Cmklr2 Full Length Transmembrane protein, His-tagged | +Inquiry |
SH-RS06800-5766S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS06800 protein, His-tagged | +Inquiry |
GRPEL1-2840H | Recombinant Human GrpE-like 1, Mitochondrial (E. coli), His-tagged | +Inquiry |
BACE1-891H | Recombinant Human BACE1 protein, His-tagged | +Inquiry |
ZDHHC8B-9600Z | Recombinant Zebrafish ZDHHC8B | +Inquiry |
◆ Native Proteins | ||
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTG2-9063HCL | Recombinant Human ACTG2 293 Cell Lysate | +Inquiry |
C9orf142-138HCL | Recombinant Human C9orf142 lysate | +Inquiry |
HOXD4-5411HCL | Recombinant Human HOXD4 293 Cell Lysate | +Inquiry |
FAM113A-6452HCL | Recombinant Human FAM113A 293 Cell Lysate | +Inquiry |
FOSB-6167HCL | Recombinant Human FOSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or10a Products
Required fields are marked with *
My Review for All Or10a Products
Required fields are marked with *
0
Inquiry Basket