Recombinant Full Length Drosophila Melanogaster Putative Mitochondrial Inner Membrane Protein (Cg6455) Protein, His-Tagged
Cat.No. : | RFL31854DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative mitochondrial inner membrane protein (CG6455) Protein (P91928) (1-739aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-739) |
Form : | Lyophilized powder |
AA Sequence : | MYRLAVRDQCKCALQRTLQQTTANNRQFGGSSSGSGGREQGRRQQEEQGQQGDQGYQGYQ SLPPHMREAGFGKVVLFVSPLAAVGGVITYAKYDDDFRKLVEKNVPGAGSVIKVALQEEP PFKGITKNVNDQIDKVKSGIETVTSTVDSVTSKVTGLFGGGSGDDKSKKSKVEPVKATPA EEKRPSKPSEVSKTEAKPVSKPAAAAAPAPAAKPKDNPLPRDVVELEKAIELSAQLAVKE YNVAIGVLKGFNDDVRKVVDKAVENGENSLWTTLKNRASARDTAVATAERAAREAQEKIV ACEIALSAAATAQNAKKVEAVRDKIKKLVDHIGNVKDELYRHKDTASVSDKYWRNVEKAR NYFIDEIESIFPGLSLADKKLNLSKEDLDLFILHAYTHVLAYQKELQRLQTDGELRLKRA IDSVRGDNDSEALRAQLEYHLEAERRKLAVENQKKIFHIHAESDKLLRLQLKKQAEAHAD HIKDIVAQRETDLTRSFKRELEDKLATEKANYKLQLAGMLGKLRGMDAALAERADAERTA NQAQALWAACQALWASVRAATPGVHYKDRLRPLKNEINAIAKVAKGDDLVAAVLESVPKE AQERGVYPEDALRERFLNVERVARRLALVPEEGAGLPIYFLSYLQSLFILRPDNPISKDE LENKPFDYSKLDTYDILNRARYHVDRSDFLQALKYMNLLQGASRKIAGEWMKEARLMLET QQAANTLMAHAAASGLLYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mitofilin |
Synonyms | Mitofilin; CG6455; MICOS complex subunit Mic60 |
UniProt ID | P91928 |
◆ Recombinant Proteins | ||
RFL2186HF | Recombinant Full Length Human Cytomegalovirus Glycoprotein N(Gn) Protein, His-Tagged | +Inquiry |
ACOX3-9304H | Recombinant Human ACOX3, GST-tagged | +Inquiry |
ZFP36L1-3802H | Recombinant Human ZFP36L1, GST-tagged | +Inquiry |
ADO-253R | Recombinant Rhesus monkey ADO Protein, His-tagged | +Inquiry |
PAT-1945S | Recombinant Streptomyces Viridochromogenes PAT Protein (1-183 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A2-8385HCL | Recombinant Human BTN3A2 293 Cell Lysate | +Inquiry |
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
CLK4-366HCL | Recombinant Human CLK4 cell lysate | +Inquiry |
SERF1B-1948HCL | Recombinant Human SERF1B 293 Cell Lysate | +Inquiry |
MGAT4A-4342HCL | Recombinant Human MGAT4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Mitofilin Products
Required fields are marked with *
My Review for All Mitofilin Products
Required fields are marked with *
0
Inquiry Basket