Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 93B(Gr93B) Protein, His-Tagged
Cat.No. : | RFL15412DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 93b(Gr93b) Protein (Q8IN23) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MSGLLVMPRILRCLNVSRISAILLRSCFLYGTFFGVITFRIERKDSQLVAINRRGYLWIC LVIRLLASCFYGYSYDAWSGQYEDMYLRAFFGFRLIGCLICSVIILVMQFWFGEELINLV NRFLQLFRRMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDL YTSVGTGMITHLCFVGYLSIGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAI SNLDKCLYLYDEIHQVSRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWGLV IKLLIDVVLLTMSVHSAVNGSRLIRRLSFENFYVTDSQSYHQKLELFLGRLQHQELRVFP LGLFEVSNELTLFFLSAMVTYLVFLVQYGMQSQQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr93b |
Synonyms | Gr93b; GR93F.2; CG31336; Putative gustatory receptor 93b |
UniProt ID | Q8IN23 |
◆ Recombinant Proteins | ||
RAVER2-1715H | Recombinant Human RAVER2 Protein (1-140 aa), His-tagged | +Inquiry |
RFL21376EF | Recombinant Full Length Upf0053 Inner Membrane Protein Ytfl(Ytfl) Protein, His-Tagged | +Inquiry |
ALDH3B1-622R | Recombinant Rat ALDH3B1 Protein | +Inquiry |
Yme1l1-3753M | Recombinant Mouse Yme1l1, His-tagged | +Inquiry |
GSTP2-7340M | Recombinant Mouse GSTP2 Protein | +Inquiry |
◆ Native Proteins | ||
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF193-128HCL | Recombinant Human ZNF193 293 Cell Lysate | +Inquiry |
PBL-01HCL | Human Peripheral blood leukocyte lysate | +Inquiry |
STAMBP-1428HCL | Recombinant Human STAMBP 293 Cell Lysate | +Inquiry |
SAMM50-2071HCL | Recombinant Human SAMM50 293 Cell Lysate | +Inquiry |
RNF4-2276HCL | Recombinant Human RNF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr93b Products
Required fields are marked with *
My Review for All Gr93b Products
Required fields are marked with *
0
Inquiry Basket