Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 8A(Gr8A) Protein, His-Tagged
Cat.No. : | RFL838DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 8a(Gr8a) Protein (Q9W367) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MSGHLGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFS GEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVS LRSEFQQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQF VLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDML KCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQ SCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLT RMACSVGTYMIYSIQFIPKFSNTYM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr8a |
Synonyms | Gr8a; CG15371; Gustatory receptor 8a |
UniProt ID | Q9W367 |
◆ Native Proteins | ||
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
Lecithin-09E | Native Egg Yolk Lecithin | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
AFP-412H | Native Human AFP Protein | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SN12C-024WCY | Human Kidney Renal Cell Carcinoma SN12C Whole Cell Lysate | +Inquiry |
CD1B & B2M-001HCL | Recombinant Human CD1B & B2M cell lysate | +Inquiry |
INSR-474HCL | Recombinant Human INSR cell lysate | +Inquiry |
KCTD4-893HCL | Recombinant Human KCTD4 cell lysate | +Inquiry |
TXK-713HCL | Recombinant Human TXK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr8a Products
Required fields are marked with *
My Review for All Gr8a Products
Required fields are marked with *
0
Inquiry Basket