Recombinant Full Length Human FAM98A Protein, GST-tagged

• Cat.No.: FAM98A-4656HF
• Product Overview: Human FAM98A full-length ORF (BAC11255.1, 1 a.a. - 519 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 519 amino acids
• Description: FAM98A (Family With Sequence Similarity 98 Member A) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is FAM98B.
• Molecular Mass: 81.8 kDa
• AA Sequence: MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQGGGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM98A family with sequence similarity 98, member A [ Homo sapiens ]
• Official Symbol: FAM98A
• Synonyms: FAM98A; family with sequence similarity 98, member A; protein FAM98A; DKFZP564F0522; DKFZp564F0522; DKFZp686O03192
• Gene ID: 25940
• mRNA Refseq: NM_015475
• Protein Refseq: NP_056290
• UniProt ID: Q8NCA5