Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 43A(Gr43A) Protein, His-Tagged
Cat.No. : | RFL16836DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 43a(Gr43a) Protein (Q9V4K2) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MEISQPSIGIFYISKVLALAPYATVRNSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGLL FDANSEIPVRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLN AYNNFRRDRWRALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIPFYS LYFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRP AMPSALHASLTKLNGETLPSEAAAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFIL VSCLLHLVATAYFLFLELLSKRDNGYLWVQMLWICFHFLRLLMVVEPCHLAARESRKTIQ IVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILI QFQRTNG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr43a |
Synonyms | Gr43a; GR43.1; CG1712; Gustatory receptor for sugar taste 43a |
UniProt ID | Q9V4K2 |
◆ Native Proteins | ||
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
PLG-54H | Native Human glu-Plasminogen | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
PerCP-02D | Native Dinophyceae sp. PerCP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF695-2077HCL | Recombinant Human ZNF695 cell lysate | +Inquiry |
Testis-822H | Hamster Testis Membrane Lysate, Total Protein | +Inquiry |
RGS5-2371HCL | Recombinant Human RGS5 293 Cell Lysate | +Inquiry |
HA-007H5N1CL | Recombinant H5N1 HA cell lysate | +Inquiry |
G3BP2-6084HCL | Recombinant Human G3BP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr43a Products
Required fields are marked with *
My Review for All Gr43a Products
Required fields are marked with *
0
Inquiry Basket