Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 39A, Isoform D(Gr39A) Protein, His-Tagged
Cat.No. : | RFL23154DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 39a, isoform D(Gr39a) Protein (P58958) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MKRNAFEELRVQLRTLKWLGVLRFTIDFNKCLVRENASEERSAWLYLIGVVGITCSLIVY STYFPSHFIMGKHNTTGNCYALINIRSCSIVTMLIYTQLYIQRFRFVALLQSILRFNQIS GSHREEGRFAFYYYTHLSLLIICMLNYAYGYWTAGVRLTTIPIYLLQYGFSYLFLGQVVV LFACIQQILLSILKYYNQVVLKNIKSSKESREFYYNFCKYNQVIWLSYTEINHCFGLLLL LVTGLILLITPSGPFYLVSTIFEGRFRQNWQFSLMSFTAILWSLPWIVLLVLAMGRNDVQ KEANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFT YMVILVQFKEMENSTKSINKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr39a |
Synonyms | Gr39a; GR39D.2; CG31622; Gustatory and pheromone receptor 39a, isoform D |
UniProt ID | P58958 |
◆ Recombinant Proteins | ||
PPP1R15A-4278R | Recombinant Rat PPP1R15A Protein, His (Fc)-Avi-tagged | +Inquiry |
DBH-2611H | Recombinant Human DBH protein(41-270 aa), N-MBP & N-His-tagged | +Inquiry |
Tubg1-233M | Recombinant Mouse Tubg1 Protein, MYC/DDK-tagged | +Inquiry |
POR-4581R | Recombinant Rat POR Protein | +Inquiry |
A5L-0283M | Recombinant MPXV A5L protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F3-6742HCL | Recombinant Human E2F3 293 Cell Lysate | +Inquiry |
MED21-4388HCL | Recombinant Human MED21 293 Cell Lysate | +Inquiry |
TTC27-682HCL | Recombinant Human TTC27 293 Cell Lysate | +Inquiry |
LRRC14-4649HCL | Recombinant Human LRRC14 293 Cell Lysate | +Inquiry |
FGD3-619HCL | Recombinant Human FGD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr39a Products
Required fields are marked with *
My Review for All Gr39a Products
Required fields are marked with *
0
Inquiry Basket