Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 36A(Gr36A) Protein, His-Tagged
Cat.No. : | RFL1790DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 36a(Gr36a) Protein (P58955) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MFDWVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISK KFNLDVYFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECVLRLFLKKPH VKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHY LVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQS IVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVFSWFLFYY TSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLD IFTITRSSSAAMIGSIITNSIFLIQYDMEYF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr36a |
Synonyms | Gr36a; CG31747; Putative gustatory receptor 36a |
UniProt ID | P58955 |
◆ Recombinant Proteins | ||
MPPE1-3738R | Recombinant Rat MPPE1 Protein | +Inquiry |
RPLT-3037S | Recombinant Staphylococcus epidermidis ATCC 12228 RPLT protein, His-tagged | +Inquiry |
SHARPIN-5388R | Recombinant Rat SHARPIN Protein | +Inquiry |
LRSAM1-4624H | Recombinant Human LRSAM1 Protein, GST-tagged | +Inquiry |
TGIF2LY-702H | Recombinant Human TGIF2LY Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
HP-193S | Native Swine Haptoglobin | +Inquiry |
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX19-281HCL | Recombinant Human TEX19 lysate | +Inquiry |
U251-010WCY | Human Glioma U251 Whole Cell Lysate | +Inquiry |
FMO9P-1535HCL | Recombinant Human FMO9P cell lysate | +Inquiry |
ANXA2-8834HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
IGSF11-1815HCL | Recombinant Human IGSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr36a Products
Required fields are marked with *
My Review for All Gr36a Products
Required fields are marked with *
0
Inquiry Basket