Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 22F(Gr22F) Protein, His-Tagged
Cat.No. : | RFL34454DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 22f(Gr22f) Protein (P58954) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MKMFQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLA MCLAMSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIAN ELLTLEGQVKDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCL PSVGLQLIIMHFHTEIILVYRYVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVVA CNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFWDFWLNIVVCDL AGKCGDQTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMI ITSFLYLVYLLQFDFMNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr22f |
Synonyms | Gr22f; CG31932; Putative gustatory receptor 22f |
UniProt ID | P58954 |
◆ Recombinant Proteins | ||
PHACTR3A-6391Z | Recombinant Zebrafish PHACTR3A | +Inquiry |
HADH-845H | Recombinant Human Hydroxyacyl-CoA Dehydrogenase, T7-tagged | +Inquiry |
RGS7BP-3878R | Recombinant Rhesus monkey RGS7BP Protein, His-tagged | +Inquiry |
CTSC-2102H | Recombinant Human CTSC Protein, GST-tagged | +Inquiry |
Mettl6-4050M | Recombinant Mouse Mettl6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Protein Z-91H | Native Human Protein Z | +Inquiry |
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACD-9096HCL | Recombinant Human ACD 293 Cell Lysate | +Inquiry |
PQLC2-2901HCL | Recombinant Human PQLC2 293 Cell Lysate | +Inquiry |
KCNK6-229HCL | Recombinant Human KCNK6 Lysate | +Inquiry |
KHDRBS1-896HCL | Recombinant Human KHDRBS1 cell lysate | +Inquiry |
ERLIN1-6551HCL | Recombinant Human ERLIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr22f Products
Required fields are marked with *
My Review for All Gr22f Products
Required fields are marked with *
0
Inquiry Basket