Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 22B(Gr22B) Protein, His-Tagged
Cat.No. : | RFL36833DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 22b(Gr22b) Protein (P84180) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MFGSSREIRPYLARQMLKTTLYGSWLLGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFL IFTLIRLAFEYRKHKLEAFKRNPVLEMINVVIGIINVLSALIVHFMNFWGSRKVGEICNE LLILEYQDFEGLNGRNCPNFNCFVIQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCL MEFSLNLNIMHYHVGVLLIYRYVWLINEQLKDLVSQLKLNPETDFSRIHQFLSLYKRLLE LNRKLVIAYEYQMTLFIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDFW LCIAACDLTEKAGDETAIILKIFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMN CRMGFKMIITTFLYLVYLVQFDYMNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr22b |
Synonyms | Gr22b; CG31931; Putative gustatory receptor 22b |
UniProt ID | P84180 |
◆ Recombinant Proteins | ||
SPG20A-6366Z | Recombinant Zebrafish SPG20A | +Inquiry |
PHOSPHO2-4090R | Recombinant Rat PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20916SF | Recombinant Full Length Salmonella Typhimurium Surface Presentation Of Antigens Protein Spar(Spar) Protein, His-Tagged | +Inquiry |
AKT3-804H | Active Recombinant Human AKT3 protein, GST-His-tagged | +Inquiry |
DUSP29-795H | Recombinant Human DUSP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG3-775HCL | Recombinant Human SCG3 cell lysate | +Inquiry |
SSSCA1-1455HCL | Recombinant Human SSSCA1 293 Cell Lysate | +Inquiry |
C17orf82-8226HCL | Recombinant Human C17orf82 293 Cell Lysate | +Inquiry |
TMEM80-930HCL | Recombinant Human TMEM80 293 Cell Lysate | +Inquiry |
MPZL2-4217HCL | Recombinant Human MPZL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr22b Products
Required fields are marked with *
My Review for All Gr22b Products
Required fields are marked with *
0
Inquiry Basket