Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 22A(Gr22A) Protein, His-Tagged
Cat.No. : | RFL35767DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 22a(Gr22a) Protein (P58951) (1-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-394) |
Form : | Lyophilized powder |
AA Sequence : | MSQPKRIHRICKGLARFTIRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTL LVLSMLPSTDDHNSVKVEVFQRNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILN ELLVLDKNHFSKLMLSECHTFNRYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVCIY IVQLEVLMVVMHFHLAVIYIYRYLWIINGQLLDMASRLRRGDSVDPDRIQLLLWLYSRLL DLNHRLTAIYDIQVTLFMATLFSVNIIVGHVLVICWINITRFSLLVIFLLFPQALIINFW DLWQGIAFCDLAESTGKKTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLL DINYEMGFRMIITNILYVVFLVQFDYMNLKFKTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr22a |
Synonyms | Gr22a; CG31662; Putative gustatory receptor 22a |
UniProt ID | P58951 |
◆ Recombinant Proteins | ||
CEACAM5-631R | Recombinant Rhesus Macaque CEACAM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
LIN28B-5090M | Recombinant Mouse LIN28B Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF10-3284H | Recombinant Human FGF10 Protein (Gln38-Ser208), C-His tagged | +Inquiry |
IL17A-491H | Active Recombinant Human IL-17A Protein, His-tagged | +Inquiry |
MMP9-1421H | Recombinant Human MMP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF212-1525HCL | Recombinant Human RNF212 cell lysate | +Inquiry |
FUT9-6111HCL | Recombinant Human FUT9 293 Cell Lysate | +Inquiry |
FAM53C-6369HCL | Recombinant Human FAM53C 293 Cell Lysate | +Inquiry |
HYOU1-2295HCL | Recombinant Human HYOU1 cell lysate | +Inquiry |
IMMP1L-5217HCL | Recombinant Human IMMP1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr22a Products
Required fields are marked with *
My Review for All Gr22a Products
Required fields are marked with *
0
Inquiry Basket