Recombinant Full Length Drosophila Melanogaster Putative Chemosensory Receptor 43B(Gr43B) Protein, His-Tagged
Cat.No. : | RFL1702DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative chemosensory receptor 43b(Gr43b) Protein (Q9V4Q0) (1-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-430) |
Form : | Lyophilized powder |
AA Sequence : | MSTGSHSPEAMWSATNFRRHQRKPNQVLHRWFFKGSAWIIYAIACGLHFFKLHYNERTNQ VEESQYHRIWSKIVVVLKVILLASPYLQYFVLGLGIYIHITLVQDSKAQNFLMSLIVLGI VIGVLRRLLIFLHLKRDRRFLKHTVNEILHITSALEQKFGMEYKCDSTLLVVYLAKLWIL TVMLDSLWYKPYFLSSIFLYWVLLEYCFAGYFIYQLILLSWYHTIILFLQRFIEDHANRL DIELHYHRRLIPLFELHLRINNLHKHVRDNVSWLSTSVYLMIFTCIFNAELLIECSLFAG DELENKIYIITDGCLGPVCVPILYVLILGMCTDRFRDAEVQLQQLFVIVQGLYMRKVRPH LLIAMVLENEHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTISTG GNISECVTHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG1339 |
Synonyms | CG1339; Uncharacterized protein CG1339 |
UniProt ID | Q9V4Q0 |
◆ Recombinant Proteins | ||
QPCTL-3726R | Recombinant Rhesus monkey QPCTL Protein, His-tagged | +Inquiry |
PPP2CA-571H | Recombinant Human PPP2CA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUSP9-5092H | Recombinant Human DUSP9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HA1-1944H | Recombinant H1N1 (A/California/06/2009) HA1 Protein, His-tagged | +Inquiry |
CSF1R-936H | Recombinant Human CSF1R Protein, DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-009C | Active Native Clostridium perfringens Neuraminidase, Type VIII | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
a-Thrombin-97H | Native Human a-Thrombin | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYB-4045HCL | Recombinant Human MYB 293 Cell Lysate | +Inquiry |
CTBP2-417HCL | Recombinant Human CTBP2 cell lysate | +Inquiry |
Uterus-549H | Human Uterus Membrane Lysate | +Inquiry |
ANKRD29-8852HCL | Recombinant Human ANKRD29 293 Cell Lysate | +Inquiry |
C17orf80-8228HCL | Recombinant Human C17orf80 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG1339 Products
Required fields are marked with *
My Review for All CG1339 Products
Required fields are marked with *
0
Inquiry Basket