Recombinant Full Length Drosophila Melanogaster Protein St7 Homolog(Cg3634) Protein, His-Tagged
Cat.No. : | RFL33179DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Protein ST7 homolog(CG3634) Protein (Q9VPB1) (1-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-537) |
Form : | Lyophilized powder |
AA Sequence : | MWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWING SDGQSESSNGSGSSSSSGSSSSSNGGAGGGGSGGAGASGSGSATTSTGTQMPECKVWRNP LNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWRERNP MQRIKSAHSALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQATQHQG AIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHENLIE TLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLSQAEM SAVEAIHRAVEFNPHVPKYLLETKRLILPPEHILKRGDSEALAYAFFHLKHWKQVEGALN LLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFILFTA GLCSITALLALATHQYPEPMGHLAQTVLTWISYPFQLLKERIEAFWPCNLLQQLSRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG3634 |
Synonyms | CG3634; Protein ST7 homolog |
UniProt ID | Q9VPB1 |
◆ Recombinant Proteins | ||
NI36-RS07445-0832S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS07445 protein, His-tagged | +Inquiry |
AKR1A1-5322H | Recombinant Human AKR1A1 protein, His-tagged | +Inquiry |
RFL29977CF | Recombinant Full Length Chlorobium Limicola Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
CCL3-79H | Recombinant Human Chemokine (C-C motif) Ligand 3 | +Inquiry |
GSTO1-498H | Recombinant Human Glutathione S-transferase Omega 1 | +Inquiry |
◆ Native Proteins | ||
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAG-1464M | RAG (mouse renal adenocarcinoma) whole cell lysate | +Inquiry |
KLF11-4932HCL | Recombinant Human KLF11 293 Cell Lysate | +Inquiry |
ENPP6-6594HCL | Recombinant Human ENPP6 293 Cell Lysate | +Inquiry |
HBZ-5615HCL | Recombinant Human HBZ 293 Cell Lysate | +Inquiry |
MYCN-4036HCL | Recombinant Human MYCN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG3634 Products
Required fields are marked with *
My Review for All CG3634 Products
Required fields are marked with *
0
Inquiry Basket