Recombinant Full Length Drosophila Melanogaster Protein Odr-4 Homolog(Cg10616) Protein, His-Tagged
Cat.No. : | RFL33220DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Protein odr-4 homolog(CG10616) Protein (Q9VTX8) (1-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-492) |
Form : | Lyophilized powder |
AA Sequence : | MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEEDADLEDLSEVR LTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVNEQSAEFKNAKKLFSDIYD LLLKSNSSFGVYTTDIAQTDFVFLSYSLADKKVLCKNYSYGNGGTFTNMEFRFVDKPFEW IQLECSYDFDDVLPILDSSRRVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAY IKKKKTKVDKLQPTSTTGGTATASSNTTDSLPRLASEGIIGGTETIRASIVLPMKCQLSK PTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRIQVYCDGLTDP YVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLFRGEAPTVVVAQAKQILDVDL DPETISVEAEGLPDDTHFNNCKMDADCIDDSGIMTSSMPKPELSRSLYMVGIAVALLVLL SSVALHFVLAER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG10616 |
Synonyms | CG10616; Protein odr-4 homolog |
UniProt ID | Q9VTX8 |
◆ Recombinant Proteins | ||
DNAJC8-1574R | Recombinant Rat DNAJC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBTD2-3564H | Recombinant Human UBTD2, GST-tagged | +Inquiry |
TENM1-6425C | Recombinant Chicken TENM1 | +Inquiry |
DEPDC7-2514H | Recombinant Human DEPDC7 protein, His-tagged | +Inquiry |
ATP7B-2172M | Recombinant Mouse ATP7B Protein | +Inquiry |
◆ Native Proteins | ||
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UTP14A-447HCL | Recombinant Human UTP14A 293 Cell Lysate | +Inquiry |
AICDA-8958HCL | Recombinant Human AICDA 293 Cell Lysate | +Inquiry |
BCL7C-8476HCL | Recombinant Human BCL7C 293 Cell Lysate | +Inquiry |
CDKN3-7609HCL | Recombinant Human CDKN3 293 Cell Lysate | +Inquiry |
PSMD11-2754HCL | Recombinant Human PSMD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG10616 Products
Required fields are marked with *
My Review for All CG10616 Products
Required fields are marked with *
0
Inquiry Basket