Recombinant Full Length Drosophila Melanogaster Probable G-Protein Coupled Receptor Mth-Like 2(Mthl2) Protein, His-Tagged
Cat.No. : | RFL157DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Probable G-protein coupled receptor Mth-like 2(mthl2) Protein (Q9VRN2) (27-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-518) |
Form : | Lyophilized powder |
AA Sequence : | EIADCSFYDTVDISEGQRLSNGSYLYEGLLIPAHLTAKYEFKLLANGDKEQVPSHVRGCV CKLRTCVRFCCPHDHIMDMGECYANMTTEENELLDPMLNVTLDDGSVVQRHYKKELMVQW DLPKPCDDMFYLDNRDIMDEYTLFENGRLLRHYDQVYLDKSEYCLQHRTFGEGNNNSIRI IPHNCLILPSRTGQTVVMITSLICLVLTIAVYLCVKKLMNLEGKCFICYMMCLFFGYLFL LLDLWELSLDFCKAAGFLGYFFVMAAFFWLSIISRHYWKCLTNPCASMNIRSERAFLLYS CFAWAMPLALTGVTYLADNVVNNEEWQPRVGDEGHCWIYTKSWSAMVYFYGPMVLLILFN ITMFVLTAKHIIDSKRTLRKIARNEGRIQKLNSDKQNYTQFLLLFTVMGMSWSFEIFSYL VQREKLWVNIFLVADYFNWSQGVIIFVLFILRRKTLVLFKKQIFPKQRAFSRSATQSTIE SISQTKRHFNMT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mthl2 |
Synonyms | mthl2; CG17795; Probable G-protein coupled receptor Mth-like 2; Protein methuselah-like 2 |
UniProt ID | Q9VRN2 |
◆ Native Proteins | ||
SERPINE1-5514R | Native Rabbit Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1 | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP4-436HCL | Recombinant Human VAMP4 293 Cell Lysate | +Inquiry |
NRN1-489HCL | Recombinant Human NRN1 cell lysate | +Inquiry |
WBP5-364HCL | Recombinant Human WBP5 293 Cell Lysate | +Inquiry |
OSBPL1A-3539HCL | Recombinant Human OSBPL1A 293 Cell Lysate | +Inquiry |
TMEM41B-951HCL | Recombinant Human TMEM41B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mthl2 Products
Required fields are marked with *
My Review for All mthl2 Products
Required fields are marked with *
0
Inquiry Basket