Recombinant Full Length Drosophila Melanogaster Probable G-Protein Coupled Receptor Mth-Like 11(Mthl11) Protein, His-Tagged
Cat.No. : | RFL21548DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Probable G-protein coupled receptor Mth-like 11(mthl11) Protein (P83118) (21-510aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-510) |
Form : | Lyophilized powder |
AA Sequence : | RDIPNCDFFDTVQLRESEKLCNGSYRYEDVVIPAKLTGKYDYEIDYDGDRVSVPKHIRGC VCKLKTCIRFCCHHKKLMAGNLCSQDVYENLTYEYTLDITQLNGSVIKKHVLNDMVVQQD LPLPCERHYSLDAETSTYDMWSLYENGSLFRHFDQRYLSKQEFCLQPNPTSTGKNYSLIV AFNCIQKPSMKMAYGRFECVRKSRLSNASIPVKFSSVFFMVITIAAYLWLPKFRSLHGKC CNLYFICLAITFLLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFA MRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIF TNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRI YFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFCNHEMFRLIR KRWVFCDSTP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mthl11 |
Synonyms | mthl11; Mth-like-11; CG31147; Probable G-protein coupled receptor Mth-like 11; Protein methuselah-like 11 |
UniProt ID | P83118 |
◆ Recombinant Proteins | ||
FGF55-5255H | Recombinant Human FGF55 protein, GST-tagged | +Inquiry |
ALG12-5710Z | Recombinant Zebrafish ALG12 | +Inquiry |
ATOH7-2515H | Recombinant Human ATOH7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL4669MF | Recombinant Full Length Mannheimia Succiniciproducens Disulfide Bond Formation Protein B(Dsbb) Protein, His-Tagged | +Inquiry |
LIN7B-3071R | Recombinant Rat LIN7B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA18-1539HCL | Recombinant Human SPATA18 293 Cell Lysate | +Inquiry |
POLL-3044HCL | Recombinant Human POLL 293 Cell Lysate | +Inquiry |
ISYNA1-349HCL | Recombinant Human ISYNA1 lysate | +Inquiry |
SLC26A7-1751HCL | Recombinant Human SLC26A7 293 Cell Lysate | +Inquiry |
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mthl11 Products
Required fields are marked with *
My Review for All mthl11 Products
Required fields are marked with *
0
Inquiry Basket