Recombinant Full Length Drosophila Melanogaster Opsin Rh3(Rh3) Protein, His-Tagged
Cat.No. : | RFL8777DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Opsin Rh3(Rh3) Protein (P04950) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MESGNVSSSLFGNVSTALRPEARLSAETRLLGWNVPPEELRHIPEHWLTYPEPPESMNYL LGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCDFMMMVKTPIFIYNSFH QGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPMEGKMTHGKAIAMIIFIY MYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYY YSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPY GVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQKRCPWLALNE KAPESSAVASTSTTQEPQQTTAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh3 |
Synonyms | Rh3; RH92CD; CG10888; Opsin Rh3; Inner R7 photoreceptor cells opsin |
UniProt ID | P04950 |
◆ Recombinant Proteins | ||
CDCA9-4707C | Recombinant Chicken CDCA9 | +Inquiry |
NCOA1-10480M | Recombinant Mouse NCOA1 Protein | +Inquiry |
RFL8967HF | Recombinant Full Length Uncharacterized Protein Rv3403C/Mt3511 (Rv3403C, Mt3511) Protein, His-Tagged | +Inquiry |
CAPN1-10699H | Recombinant Human CAPN1, GST-tagged | +Inquiry |
CTW5-918C | Recombinant Chlamydia trachomatis CTW5 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELPLG-1089HCL | Recombinant Human SELPLG cell lysate | +Inquiry |
SPATA3-625HCL | Recombinant Human SPATA3 lysate | +Inquiry |
GINS1-5934HCL | Recombinant Human GINS1 293 Cell Lysate | +Inquiry |
CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
RPL30-2207HCL | Recombinant Human RPL30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rh3 Products
Required fields are marked with *
My Review for All Rh3 Products
Required fields are marked with *
0
Inquiry Basket