Recombinant Full Length Drosophila Melanogaster Opsin Rh2(Rh2) Protein, His-Tagged
Cat.No. : | RFL31780DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Opsin Rh2(Rh2) Protein (P08099) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MERSHLPETPFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKIL GLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYY ETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFI WMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYS YWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYL VICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTD EPKPDAPASDTETTSEADSKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh2 |
Synonyms | Rh2; CG16740; Opsin Rh2; Ocellar opsin |
UniProt ID | P08099 |
◆ Native Proteins | ||
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL28-2209HCL | Recombinant Human RPL28 293 Cell Lysate | +Inquiry |
UCHL3-534HCL | Recombinant Human UCHL3 293 Cell Lysate | +Inquiry |
DNHL1-6860HCL | Recombinant Human DNHL1 293 Cell Lysate | +Inquiry |
TNFRSF13C-831RCL | Recombinant Rat TNFRSF13C cell lysate | +Inquiry |
JC-2122M | JC (mouse mammary adenocarcinoma) whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rh2 Products
Required fields are marked with *
My Review for All Rh2 Products
Required fields are marked with *
0
Inquiry Basket