Recombinant Full Length Drosophila Melanogaster Odorant Receptor 43B(Or43B) Protein, His-Tagged
Cat.No. : | RFL7636DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 43b(Or43b) Protein (P81918) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MFGHFKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKNDFGIGRKIWRVFSFTYNMVIL PVSFPINYVIHLAEFPPELLLQSLQLCLNTWCFALKFFTLIVYTHRLELANKHFDELDKY CVKPAEKRKVRDMVATITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDR TQMYIQSFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDP SYMFKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRF GIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQP MTFTAMNIFNINLATNINVAKFAFTVYAIASGMNLDQKLSIKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or43b |
Synonyms | Or43b; AN7; DOR25A.1; OR44A.1; CG17853; Odorant receptor 43b |
UniProt ID | P81918 |
◆ Recombinant Proteins | ||
CD4-26367TH | Recombinant Human CD4 | +Inquiry |
BHLHE23-3666H | Recombinant Human BHLHE23 protein, His-tagged | +Inquiry |
DKFZp686O24166-2779H | Recombinant Human DKFZp686O24166 protein, His-tagged | +Inquiry |
PCBD1-30550TH | Recombinant Human PCBD1, His-tagged | +Inquiry |
TNFSF8-3577H | Recombinant Human TNFSF8 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
TF-135R | Native Rabbit Transferrin | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRB1-6062HCL | Recombinant Human GABRB1 293 Cell Lysate | +Inquiry |
WFDC5-319HCL | Recombinant Human WFDC5 293 Cell Lysate | +Inquiry |
SCFD2-1566HCL | Recombinant Human SCFD2 cell lysate | +Inquiry |
STK19-1713HCL | Recombinant Human STK19 cell lysate | +Inquiry |
PGM2L1-3250HCL | Recombinant Human PGM2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or43b Products
Required fields are marked with *
My Review for All Or43b Products
Required fields are marked with *
0
Inquiry Basket